Dbfetch

ID   U14756; SV 1; linear; genomic DNA; STD; HUM; 413 BP.
XX
AC   U14756;
XX
DT   11-AUG-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I antigen HLA-B (allele HLAB15UW1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[[published erratum appears in Immunogenetics 1995;42(4):308]]
RP   1-413
RX   DOI; 10.1007/BF00164983.
RX   PUBMED; 7797264.
RA   Garber T.L., Butler L.M., Trachtenberg E.A., Erlich H.A., Rickards O.,
RA   De Stefano G., Watkins D.I.;
RT   "HLA-B alleles of the Cayapa of Ecuador: new B39 and B15 alleles";
RL   Immunogenetics 42(1):19-27(1995).
XX
RN   [2]
RP   1-413
RA   Garber T.L.;
RT   ;
RL   Submitted (16-SEP-1994) to the INSDC.
RL   Theodore L. Garber, Wisconsin Regional Primate Research Cntr., University
RL   of Wisconsin-Madison, 1220 Capitol Ct., Madison, WI 53715, USA
XX
DR   MD5; ef88b26e7fbd82fa540e03f03ad0f7de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..413
FT                   /organism="Homo sapiens"
FT                   /isolate="Cayapa, Native South American"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..413
FT                   /gene="HLA-B"
FT   CDS             <1..>413
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele HLAB15UW1"
FT                   /db_xref="IMGT/HLA:B*35:43:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q29660"
FT                   /protein_id="AAC50171.1"
FT                   /translation="FDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYL"
XX
SQ   Sequence 413 BP; 88 A; 128 C; 147 G; 50 T; 0 other;
     ggttcgacag cgacgccgcg agtccgagga cggagccccg ggcgccatgg atagagcagg        60
     aggggccgga gtattgggac cggaacacac agatcttcaa gaccaacaca cagacttacc       120
     gagagagcct gcggaacctg cgcggctact acaaccagag cgaggccggg tctcacaccc       180
     tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc gggcatgacc       240
     agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg       300
     cggcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt gaggcggagc       360
     agtggagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac ctg              413
//