spacer

EBI Dbfetch

ID   U11267; SV 1; linear; mRNA; STD; HUM; 968 BP.
XX
AC   U11267;
XX
DT   23-JUL-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human HLA-B37 (B-3701) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Hurley C.K., Bei M., Rodriguez S., Johnson A.;
RT   "HLA-B71";
RL   Unpublished.
XX
RN   [2]
RP   1-968
RA   Hurley C.K.;
RT   ;
RL   Submitted (23-JUN-1994) to the INSDC.
RL   Carolyn K. Hurley, Microbiology, Georgetown University School of Medicine,
RL   3900 Reservoir Road, N.W., Washington, D.C. 20007 USA
XX
DR   MD5; 3ac5fe875003b5b958dc6ba38d4fcf68.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..968
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="GU2760"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A2, CW6, B37 / A-, CW7, B71"
FT                   /cell_line="B lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>968
FT                   /codon_start=1
FT                   /gene="B-3701"
FT                   /product="HLA-B37"
FT                   /function="peptide presentation; histocompatibility
FT                   molecule"
FT                   /db_xref="GOA:P18463"
FT                   /db_xref="H-InvDB:HIT000218036.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*37:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18463"
FT                   /citation=[1]
FT                   /protein_id="AAA19927.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRT
FT                   LLRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVV"
XX
SQ   Sequence 968 BP; 196 A; 310 C; 314 G; 148 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggctccca ctccatgagg tatttccaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     gacctgcgga ccctgctccg ctactacaac cagagcgagg ccgggtctca caccatccag       360
     aggatgtctg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcat                                                                968
//


spacer
spacer