Dbfetch

ID   U11265; SV 1; linear; mRNA; STD; HUM; 968 BP.
XX
AC   U11265;
XX
DT   23-JUL-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human HLA-B35 (B-3501) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Hurley C.K., Bei M., Rodriguez S., Johnson A.;
RT   "HLA-B71";
RL   Unpublished.
XX
RN   [2]
RP   1-968
RA   Hurley C.K.;
RT   ;
RL   Submitted (23-JUN-1994) to the INSDC.
RL   Carolyn K. Hurley, Microbiology, Georgetown University School of Medicine,
RL   3900 Reservoir Road, N.W., Washington, D.C. 20007 USA
XX
DR   MD5; 97bbd6353abe062acec91a250979d15c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..968
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="GU2739"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A32,A11; CW-,CW4; B71,B35."
FT                   /cell_line="B lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>968
FT                   /codon_start=1
FT                   /gene="B-3501"
FT                   /product="HLA-B35"
FT                   /function="peptide presentation; histocompatibility
FT                   molecule"
FT                   /db_xref="H-InvDB:HIT000218034_03.4"
FT                   /db_xref="IMGT/HLA:B*35:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="UniProtKB/TrEMBL:O19626"
FT                   /citation=[1]
FT                   /protein_id="AAA19925.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVV"
XX
SQ   Sequence 968 BP; 197 A; 309 C; 315 G; 147 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcat                                                                968
//