spacer

EBI Dbfetch

ID   U09740; SV 1; linear; mRNA; STD; HUM; 1269 BP.
XX
AC   U09740;
XX
DT   29-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class I antigen HLA-A33 (HLA-A*3303) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1111/j.1399-0039.1995.tb02418.x.
RX   PUBMED; 7725315.
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Molecular characterization of a novel HLA-A33 allele (A*3303)";
RL   Tissue Antigens 45(1):73-76(1995).
XX
RN   [2]
RP   1-1269
RA   Vicario J.L.;
RT   ;
RL   Submitted (13-MAY-1994) to the INSDC.
RL   Jose L. Vicario, Histocompatibility, Centro de Transfusion de Madrid,
RL   Menendez Pelayo, 65, Madrid, Spain, 28009
XX
DR   MD5; fecf4ed12165f4093cd82446e045f986.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="A33 B35"
FT                   /dev_stage="adult"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT                   /gene="HLA-A*3303"
FT                   /number=1
FT   sig_peptide     1..72
FT                   /gene="HLA-A*3303"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A*3303"
FT                   /product="MHC class I antigen HLA-A33"
FT                   /db_xref="GOA:P16190"
FT                   /db_xref="H-InvDB:HIT000217932.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*33:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16190"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA79865.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   misc_feature    73..342
FT                   /gene="HLA-A*3303"
FT                   /note="alpha-1 domain"
FT   exon            74..343
FT                   /gene="HLA-A*3303"
FT                   /number=2
FT   misc_feature    343..618
FT                   /gene="HLA-A*3303"
FT                   /note="alpha-2 domain"
FT   exon            344..619
FT                   /gene="HLA-A*3303"
FT                   /number=3
FT   misc_feature    619..894
FT                   /gene="HLA-A*3303"
FT                   /note="alpha-3 domain"
FT   exon            620..895
FT                   /gene="HLA-A*3303"
FT                   /number=4
FT   misc_feature    895..1011
FT                   /gene="HLA-A*3303"
FT                   /note="transmembrane domain"
FT   exon            896..1012
FT                   /gene="HLA-A*3303"
FT                   /number=5
FT   misc_feature    1012..1095
FT                   /gene="HLA-A*3303"
FT                   /note="cytoplasmic domain"
FT   exon            1013..1041
FT                   /gene="HLA-A*3303"
FT                   /number=6
FT   exon            1042..1093
FT                   /gene="HLA-A*3303"
FT                   /number=7
FT   exon            1094..>1269
FT                   /gene="HLA-A*3303"
FT                   /number=8
FT   3'UTR           1099..>1269
FT                   /gene="HLA-A*3303"
XX
SQ   Sequence 1269 BP; 246 A; 375 C; 414 G; 234 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcacca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacggaat gtgaaggccc actcacagat tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctc cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctagttct ctttggagct       960
     gtgttcgctg gagctgtggt cgctgctgtg aggtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtgaga cagctgcctt gtgtgggact gagaggcaag atttgttcct      1140
     gcccttccct ttgtgacttg aagtaccctg actttgtttc tgcaaaggca cctgcatgtg      1200
     tctgtgttct tgtaggcata atgtgaggag gtggggagac caccccaccc ccatgtccac      1260
     catgaccct                                                              1269
//


spacer
spacer