spacer

EBI Dbfetch

ID   U09201; SV 1; linear; mRNA; STD; HUM; 126 BP.
XX
AC   U09201;
XX
DT   11-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class II histocompatibility antigen HLA-DR7 beta chain (DRB1-0701
DE   allele) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   30-61
RX   DOI; 10.1111/j.1399-0039.1994.tb02312.x.
RX   PUBMED; 8016840.
RA   Guethlein L.A., Bias W.B., Schmeckpeper B.J.;
RT   "Re-evaluation of DRB1*0702: evidence for only one allele, DRB1*0701,
RT   encoding the beta chain of the HLA-DR7 antigen";
RL   Tissue Antigens 43(2):124-128(1994).
XX
RN   [2]
RP   1-126
RA   Schmeckpeper B.J.;
RT   ;
RL   Submitted (25-APR-1994) to the INSDC.
RL   Barbara J. Schmeckpeper, Johns Hopkins University School of Medicine,
RL   Medicine/Immunogenetics Laboratories, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 8bd4a0b20dc4e59bcc00d840cfc5c4a1.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000433975; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
DR   H-InvDB; HIT000217890_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..126
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p23.1"
FT                   /isolate="LBF (LBUF, 10W9048), DNA No. Typ 45"
FT                   /mol_type="mRNA"
FT                   /cell_line="LBF (LBUF, 10W9048)"
FT                   /db_xref="taxon:9606"
FT   gene            1..126
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>126
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II histocompatibility antigen HLA-DR7
FT                   beta chain"
FT                   /note="HLA-DRB1-0701 allele"
FT                   /db_xref="H-InvDB:HIT000217890_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*07:01:01:01"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:O19622"
FT                   /protein_id="AAA17992.1"
FT                   /translation="VHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNG"
XX
SQ   Sequence 126 BP; 25 A; 38 C; 33 G; 30 T; 0 other;
     agtccatcct gaggtgactg tgtatcctgc caagactcag cccctgcagc accacaacct        60
     cctggtctgc tctgtgagtg gtttctatcc aggcagcatt gaagtcaggt ggttccggaa       120
     cggcca                                                                  126
//


spacer
spacer