Dbfetch

ID   U09200; SV 1; linear; unassigned DNA; STD; HUM; 175 BP.
XX
AC   U09200;
XX
DT   11-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Human MHC class II histocompatibility antigen beta chain (HLA-DRB1) gene,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-175
RA   Schmeckpeper B.J., Guethlein L.A., Wood W.W., Hart J.M., Bias W.B.;
RT   "A new DRB1 allele: a combination of DR11 and DR14";
RL   Unpublished.
XX
RN   [2]
RP   1-175
RA   Schmeckpeper B.J.;
RT   ;
RL   Submitted (25-APR-1994) to the INSDC.
RL   Barbara J. Schmeckpeper, Johns Hopkins University School of Medicine,
RL   Medicine/Immunogenetics Laboratories, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 2157e1272dc53cb9d31ef5ad7cb8a7b8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..175
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p23.1"
FT                   /isolate="MREC42996 DB34129 FAM4457 BMT189"
FT                   /mol_type="unassigned DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..175
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>175
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II histocompatibility antigen beta
FT                   chain"
FT                   /db_xref="GOA:Q29651"
FT                   /db_xref="IMGT/HLA:DRB1*11:13:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29651"
FT                   /protein_id="AAA17991.1"
FT                   /translation="ERVRFLDRYFHNQEEFVRFDSDVGEFRAVTELGRPDEEYWNSQKD
FT                   LLERRRAAVDTYC"
XX
SQ   Sequence 175 BP; 34 A; 42 C; 71 G; 28 T; 0 other;
     gagcgggtgc ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac        60
     agcgacgtgg gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg       120
     aacagccaga aggacctcct ggagcggagg cgggccgcgg tggacaccta ttgca            175
//