spacer

EBI Dbfetch

ID   U08932; SV 1; linear; unassigned DNA; STD; HUM; 219 BP.
XX
AC   U08932;
XX
DT   08-SEP-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human clone F1363 MHC class II histocompatibility antigen (HLA-DRB) gene,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Dinauer D.M., Glumm R., Baxter-Lowe L.A.;
RT   "Evolutionary and Functional Implications of a Novel HLA-DRB Polymorphism
RT   at Codon 86";
RL   Unpublished.
XX
RN   [2]
RP   1-219
RA   Baxter-Lowe L.A.;
RT   ;
RL   Submitted (15-APR-1994) to the INSDC.
RL   Lee Ann Baxter-Lowe, The Blood Center of Southeastern Wisconsin, 1701 W.
RL   Wisconsin Ave, Milwaukee, WI 53201-2178, USA
XX
DR   MD5; 3fb69b2ead146a897b719599e5331ed9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..219
FT                   /organism="Homo sapiens"
FT                   /mol_type="unassigned DNA"
FT                   /clone="F1363"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>219
FT                   /codon_start=1
FT                   /gene="HLA-DRB"
FT                   /product="MHC class II histocompatibility antigen"
FT                   /db_xref="GOA:Q29650"
FT                   /db_xref="IMGT/HLA:DRB1*11:14:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29650"
FT                   /protein_id="AAA21276.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDE
FT                   EYWNSQKDILEDERAAVDTYCRHNYGVG"
XX
SQ   Sequence 219 BP; 49 A; 49 C; 82 G; 39 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgaggagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttggt                              219
//


spacer
spacer