spacer

EBI Dbfetch

ID   U08274; SV 1; linear; genomic DNA; STD; HUM; 219 BP.
XX
AC   U08274;
XX
DT   08-SEP-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human clone 1101A58 MHC class II histocompatibility antigen (HLA-DRB1)
DE   gene,  partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1016/0198-8859(95)00107-7.
RX   PUBMED; 8655358.
RA   Dinauer D.M., Glumm R., Baxter-Lowe L.A.;
RT   "DRB1*1316: evolutionary and functional implications of a novel
RT   polymorphism at codon 86";
RL   Hum. Immunol. 45(1):37-41(1996).
XX
RN   [2]
RP   1-219
RA   Baxter-Lowe L.A.;
RT   ;
RL   Submitted (01-APR-1994) to the INSDC.
RL   The Blood Center of Southeastern Wisconsin, 1701 W. Wisconsin Ave,
RL   Milwaukee,, WI 53233, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-219
RA   Baxter-Lowe L.A.;
RT   ;
RL   Submitted (01-DEC-1997) to the INSDC.
RL   The Blood Center of Southeastern Wisconsin, 1701 W. Wisconsin Ave,
RL   Milwaukee,, WI 53233, USA
XX
DR   MD5; 443b0d74a5ce28e2d8b9534358cc4f31.
XX
CC   On Dec 1, 1997 this sequence version replaced gi:746408.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..219
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="1101A58"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>219
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II histocompatibility antigen"
FT                   /db_xref="GOA:Q29646"
FT                   /db_xref="IMGT/HLA:DRB1*13:14:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29646"
FT                   /protein_id="AAB87709.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDFLEDRRAAVDTYCRHNYGVG"
XX
SQ   Sequence 219 BP; 47 A; 51 C; 81 G; 40 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggact tcctggaaga caggcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttggt                              219
//


spacer
spacer