spacer

EBI Dbfetch

ID   U07234; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   U07234;
XX
DT   05-AUG-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class I HLA-A19 (HLA-A-3004 allele) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1111/j.1399-0039.1994.tb02393.x.
RX   PUBMED; 7871528.
RA   Olerup O., Daniels T., Baxter-Lowe L.A.;
RT   "Correct sequence of the A*3001 allele obtained by PCR-SSP typing and
RT   automated nucleotide sequencing";
RL   Tissue Antigens 44(4):265-267(1994).
XX
RN   [2]
RP   1-1098
RA   Baxter-Lowe L.;
RT   ;
RL   Submitted (01-MAR-1994) to the INSDC.
RL   Lee Ann Baxter-Lowe, The Blood Center of Southeastern Wisconsin, 1701 W.
RL   Wisconsin Ave., Milwaukee, WI 53233 USA
XX
DR   MD5; 990f406a55995556a432356c31aa9679.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="RSH 9021"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A19"
FT                   /product="MHC class I histocompatibility antigen"
FT                   /note="HLA-A-3004 allele"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="H-InvDB:HIT000217655.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="AAA70162.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 1098 BP; 221 A; 327 C; 367 G; 183 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta tgaacagcac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgttgggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer