spacer

EBI Dbfetch

ID   U06835; SV 1; linear; mRNA; STD; HUM; 822 BP.
XX
AC   U06835;
XX
DT   15-APR-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human clone RSH 34 MHC class I HLA-Cw mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Yang S., Cereb N.;
RT   "Nucleotide Sequence Analysis of HLA-Cw Blank Alleles from Seven B Cell
RT   Lines";
RL   Unpublished.
XX
RN   [2]
RP   1-822
RA   Kong Y.;
RT   ;
RL   Submitted (16-FEB-1994) to the INSDC.
RL   Yuan Kong, Biochemical Immunogenetics, Memorial Sloan-Kettering Cancer
RL   Center, 1275 York Avenue, New York, NY 10021, USA
XX
DR   MD5; 689415649d3b69f8dd29e5e4da02e2d9.
DR   H-InvDB; HIT000217628_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /clone="RSH 34"
FT                   /cell_line="RSH"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /number=2
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I histocompatibility antigen"
FT                   /db_xref="GOA:Q95604"
FT                   /db_xref="H-InvDB:HIT000217628_02.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*17:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95604"
FT                   /protein_id="AAA17674.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTIQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAAREAEQLRAYLEGEC
FT                   VEWLRGYLENGKETLQRAERPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLQEPCTLRW"
FT   exon            271..546
FT                   /gene="HLA-Cw"
FT                   /number=3
FT   exon            547..822
FT                   /gene="HLA-Cw"
FT                   /number=4
XX
SQ   Sequence 822 BP; 172 A; 249 C; 288 G; 113 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac catccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtataa ccagttcgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgcggcggac acggcggctc       420
     agatctccca gcgcaagttg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcggat acctggagaa cgggaaggag acgctgcagc       540
     gcgcggaacg cccaaagaca cacgtgaccc accatcccgt ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gggaggacca aactcaggac accgagcttg tggagaccag gccagcagga gatggaacct       720
     tccagaagtg ggcagccgtg gtggtgcctt ctggacaaga acagagatac acgtgccatg       780
     tgcagcacga ggggctgcag gagccctgca ccctgagatg ga                          822
//


spacer
spacer