spacer

EBI Dbfetch

ID   U06487; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   U06487;
XX
DT   12-APR-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human clone LUY 2/12 MHC class I histocompatibility antigen (HLA-Cw) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RX   DOI; 10.1111/j.1399-0039.1994.tb02379.x.
RX   PUBMED; 7839353.
RA   Cereb N., Choi J.W., Lee S., Maye P., Kong Y., Yang S.Y.;
RT   "Identification of two new HLA-C alleles, Cw*1203 and Cw*1402, from the
RT   sequence analysis of seven HLA homozygous cell lines carrying HLA-C blank";
RL   Tissue Antigens 44(3):193-195(1994).
XX
RN   [2]
RP   1-1101
RA   Yang S.Y.;
RT   ;
RL   Submitted (14-FEB-1994) to the INSDC.
RL   Soo Young Yang, Biochemical Immunogenetics, Memorial Sloan-Kettering Cander
RL   Center, 1275 York Avenue, New York, NY 10021, USA
XX
DR   MD5; 627077b3cc27534feaccbb1e675b522a.
DR   Ensembl-Gn; ENSG00000237022; homo_sapiens.
DR   Ensembl-Tr; ENST00000438171; homo_sapiens.
DR   EuropePMC; PMC1351924; 16435885.
XX
CC   On Mar 28, 1996 this sequence version replaced gi:600483.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="somatic"
FT                   /clone="LUY 2/12"
FT                   /cell_line="LUY"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I histocompatibility antigen"
FT                   /db_xref="GOA:P30510"
FT                   /db_xref="H-InvDB:HIT000217608.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30510"
FT                   /protein_id="AAA92994.1"
FT                   /translation="MRVMAPRTLILLLSGTLALTETWACSHSMRYFSTSVSRPGRGGPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMFGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1101 BP; 210 A; 337 C; 378 G; 176 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggaaccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     cgcggggggc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     tggatgtttg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer