spacer

EBI Dbfetch

ID   U04787; SV 1; linear; mRNA; STD; HUM; 1092 BP.
XX
AC   U04787;
XX
DT   08-JAN-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC Class I HLA heavy chain (HLA-B-7301) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1092
RX   DOI; 10.1111/j.1399-0039.1994.tb02344.x.
RX   PUBMED; 7524186.
RA   Parham P., Arnett K.L., Adams E.J., Barber L.D., Domena J.D., Stewart D.,
RA   Hildebrand W.H., Little A.M.;
RT   "The HLA-B73 antigen has a most unusual structure that defines a second
RT   lineage of HLA-B alleles";
RL   Tissue Antigens 43(5):302-313(1994).
XX
RN   [2]
RP   1-1092
RA   Domena J.D.;
RT   ;
RL   Submitted (30-DEC-1993) to the INSDC.
RL   John D. Domena, Department of Cell Biology, Stanford University, Sherman
RL   Fairchild Bldg., Stanford, CA 94305-5400, USA
XX
DR   MD5; 146849079e109ee027aef4d300215d15.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
CC   NCBI gi: 439858
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1092
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA  A2/28;  B73/5;  Cw7/8"
FT                   /clone="18.4, 18.12, 19.3"
FT                   /cell_line="LK707"
FT                   /cell_type="EBV-transformed B-cell"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1092
FT                   /codon_start=1
FT                   /gene="HLA-B-7301"
FT                   /product="MHC Class I HLA heavy chain"
FT                   /note="NCBI gi: 439859"
FT                   /db_xref="GOA:Q31612"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*73:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q31612"
FT                   /protein_id="AAA53175.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKAKAQTDRVGLRN
FT                   LRGYYNQSEDGSHTWQTMYGCDMGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQSTIPIVGIVAGLAVLVVTVAVVAVVAAVMCRRKSSGG
FT                   KGGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1092 BP; 214 A; 336 C; 367 G; 175 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttccaca cctccgtgtc ccggcctggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tgcaaggcca aggcacagac tgaccgagtg       300
     ggcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca cacttggcag       360
     acgatgtatg gctgcgacat ggggccggac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gacacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agaacagaga       840
     tacacgtgcc atgtgcagca cgaggggctg caggagccct gcaccctgag atggaagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt ccttgtggtc       960
     accgtagctg tggtcgctgt ggtcgctgct gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctactctca ggctgcgtcc agcgacagtg cccagggctc tgatgtgtct      1080
     ctcacagctt ga                                                          1092
//


spacer
spacer