spacer

EBI Dbfetch

ID   U03859; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U03859;
XX
DT   12-DEC-1993 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC Class I HLA-B-1501 mRNA, complete cds.
XX
KW   Human MHC, Class I, HLA-B-1501.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Hildebrand W.H., Domena J.D., Shen S.Y., Lau M., Terasaki P.I., Marsh S.G.,
RA   Guttridge M.G., Bias W.B., Parham P.;
RT   "HLA-B15: A widespread and diverse family of hla-b alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1089
RA   Domena J.D.;
RT   ;
RL   Submitted (30-NOV-1993) to the INSDC.
RL   John D. Domena Ph.D., Department of Cell Biology, Stanford University,
RL   Sherman Fairchild Bldg., Stanford, CA 94305-5400, USA
XX
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="HLA A1/3; B15/7; Cw3/-"
FT                   /clone="18.2, 18.7, 19.14"
FT                   /cell_line="PP"
FT                   /cell_type="EBV-transformed B-cell"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B-1501"
FT                   /db_xref="GOA:P30464"
FT                   /db_xref="H-InvDB:HIT000217524.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*15:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30464"
FT                   /protein_id="AAA03601.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            1..73
FT   exon            74..343
FT   exon            344..619
FT   exon            620..895
FT   exon            896..1021
FT   exon            1022..1054
FT   exon            1055..1089
XX
SQ   Sequence 1089 BP; 221 A; 338 C; 360 G; 170 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagtgg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer