Dbfetch

ID   U03698; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U03698;
XX
DT   28-NOV-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human HLA B-40011 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1007/BF00404425.
RX   PUBMED; 2437025.
RA   Ways J.W., Lawlor D.A., Wan A.M., Parham P.;
RT   "A transposable epitope of HLA-B7, B40 molecules";
RL   Immunogenetics 25(5):323-328(1987).
XX
RN   [2]
RP   1-1089
RA   Domena J.D.;
RT   ;
RL   Submitted (22-NOV-1993) to the INSDC.
RL   John D. Domena Ph.D., Department of Cell Biology, Stanford University,
RL   Sherman Fairchild Bldg., Stanford, CA 94305-5400, USA
XX
DR   MD5; 4a194f9c1fa6a35515ec688949370d58.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="F"
FT                   /haplotype="B60/B67"
FT                   /clone="18.4 19.1"
FT                   /cell_line="W7079"
FT                   /cell_type="EBV-transformed B-cell"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /product="HLA B-40011"
FT                   /db_xref="GOA:Q04826"
FT                   /db_xref="H-InvDB:HIT000217520.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*40:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04826"
FT                   /protein_id="AAA03719.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            74..343
FT   exon            344..619
FT   exon            620..895
FT   exon            896..1021
FT   exon            1022..1054
FT   exon            1055..1089
XX
SQ   Sequence 1089 BP; 221 A; 334 C; 360 G; 174 T; 0 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg cgggctccca ctccatgagg tatttccaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatctc ccagcgcaag ttggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gacaagctgg agcgcgctga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagttc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//