spacer

EBI Dbfetch

ID   U03697; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   U03697;
XX
DT   28-NOV-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human HLA A-2601 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1111/j.1399-0039.1993.tb01982.x.
RX   PUBMED; 8475492.
RA   Madrigal J.A., Hildebrand W.H., Belich M.P., Benjamin R.J., Little A.,
RA   Zemmour J., Ennis P.D., Ward F.E., Petzl-Erler M.L., Parham P.;
RT   "Structural diversity in the HLA-A10 family of alleles: correlations with
RT   serology";
RL   Tissue Antigens 41(2):72-80(1993).
XX
RN   [2]
RP   1-1098
RA   Domena J.D.;
RT   ;
RL   Submitted (22-NOV-1993) to the INSDC.
RL   John D. Domena Ph.D., Department of Cell Biology, Stanford University,
RL   Sherman Fairchild Bldg., Stanford, CA 94305-5400, USA
XX
DR   MD5; 762a22d70f5ba195ffaae11de6b8acef.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="A26 B8 Cw7"
FT                   /cell_line="MGAR (9014)"
FT                   /cell_type="EBV-transformed B-cell"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /product="HLA A-2601"
FT                   /db_xref="GOA:P30450"
FT                   /db_xref="H-InvDB:HIT000217519.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*26:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30450"
FT                   /protein_id="AAA03720.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            74..343
FT   exon            344..619
FT   exon            620..895
FT   exon            896..1021
FT   exon            1022..1054
FT   exon            1055..1098
XX
SQ   Sequence 1098 BP; 216 A; 329 C; 373 G; 180 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacggaat gtgaaggccc actcacagac tgaccgagcg       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     aggatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcttacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggagacgg cccatgaggc ggagcagtgg       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggga ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct       960
     gtgatcgctg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer