Dbfetch

ID   U03291; SV 1; linear; genomic DNA; STD; HUM; 433 BP.
XX
AC   U03291;
XX
DT   24-NOV-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human variant HLA-DRB1-1113 gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-433
RX   DOI; 10.1111/j.1399-0039.1995.tb02429.x.
RX   PUBMED; 7792759.
RA   Rosenberg S.M., Wollenzien T.F., Johnson M.M., Eberly L., Hurley C.K.,
RA   Reinsmoen N.L., Steiner N., Goeken N.E.;
RT   "A description of a new DR allele, DRB1*1113";
RL   Tissue Antigens 45(2):125-128(1995).
XX
RN   [2]
RP   1-433
RA   Goeken N.E.;
RT   ;
RL   Submitted (09-NOV-1993) to the INSDC.
RL   Nancy E. Goeken, Tissue Typing Laboratory, VA Medical Center, Highway 6
RL   West, Iowa City, IA 52241, USA
XX
DR   MD5; 98524ad01085e6380db92c5a7cba41d1.
XX
CC   On Jan 28, 1995 this sequence version replaced gi:424097.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..433
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             17..427
FT                   /codon_start=1
FT                   /gene="HLA-DRB1-1113"
FT                   /note="label:SBOOTS930814-10"
FT                   /db_xref="GOA:Q29635"
FT                   /db_xref="IMGT/HLA:DRB1*11:13:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29635"
FT                   /protein_id="AAA99536.1"
FT                   /translation="MVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQE
FT                   EFVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLERRRAAVDTYCRHNYGVVESFTVQRR
FT                   VHPXVTVYPSKTQPLQHHXLLVCSVSRLNPYX"
XX
SQ   Sequence 433 BP; 88 A; 112 C; 137 G; 93 T; 3 other;
     gtagatccga ttactgatgg tgctgagctc cccactggct ttggctgggg acaccagacc        60
     acgtttcttg gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg       120
     gttcctggac agatacttcc ataaccagga ggagttcgtg cgcttcgaca gcgacgtggg       180
     ggagttccgg gcggtgacgg agctggggcg gcctgatgag gagtactgga acagccagaa       240
     ggacctcctg gagcggaggc gggccgcggt ggacacctat tgcagacaca actacggggt       300
     tgtggagagc ttcacagtgc agcggcgagt ccatcctang gtgactgtgt atccttcaaa       360
     gacccagccc ctgcagcacc acancctcct ggtctgctct gtgagtcgac tcaatccata       420
     tgamtagtag atc                                                          433
//