Dbfetch

ID   U02935; SV 2; linear; genomic DNA; STD; HUM; 1332 BP.
XX
AC   U02935;
XX
DT   22-JAN-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens HLA-A2 gene, enhancer region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1332
RX   DOI; 10.1016/0198-8859(94)90087-6.
RX   PUBMED; 7836067.
RA   Balas A., Garcia-Sanchez F., Gomez-Reino F., Vicario J.L.;
RT   "HLA class I allele (HLA-A2) expression defect associated with a mutation
RT   in its enhancer B inverted CAT box in two families";
RL   Hum. Immunol. 41(1):69-73(1994).
XX
RN   [2]
RP   1-1332
RA   Vicario J.L.;
RT   ;
RL   Submitted (26-OCT-1993) to the INSDC.
RL   Histocompatability, Centro de Transfusion de Madrid, Menendez Pelayo, 65,
RL   Madrid 28009, Spain
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1332
RA   Balas A.;
RT   ;
RL   Submitted (24-JUL-2003) to the INSDC.
RL   Histocompatability, Centro de Transfusion de Madrid, Menendez Pelayo, 65,
RL   Madrid 28009, Spain
XX
DR   MD5; 890af1eae830e562e1bd68b74bb15a0e.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
CC   On Jul 24, 2003 this sequence version replaced gi:414545.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1332
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A2 Cblank B38 DRB1*1301 DQ6"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   regulatory      33..46
FT                   /note="Enhancer A"
FT                   /regulatory_class="enhancer"
FT   regulatory      53..69
FT                   /note="Interferon Response Sequence"
FT                   /regulatory_class="enhancer"
FT   regulatory      131..141
FT                   /note="Enhancer B"
FT                   /regulatory_class="enhancer"
FT   misc_feature    134
FT                   /phenotype="low expression of HLA-A2"
FT                   /product="HLA-A2"
FT                   /note="Nucleotide change compared to all other MHC
FT                   sequences"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      157..161
FT                   /note="CAT box"
FT                   /regulatory_class="CAAT_signal"
FT   regulatory      183..188
FT                   /note="TATA box"
FT                   /regulatory_class="TATA_box"
FT   mRNA            <235..>1332
FT                   /product="HLA-A2"
FT   CDS             235..1332
FT                   /codon_start=1
FT                   /product="HLA-A2"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*02:01:01:02L"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="PDB:4NNX"
FT                   /db_xref="PDB:4NNY"
FT                   /db_xref="PDB:4NO0"
FT                   /db_xref="PDB:4NO2"
FT                   /db_xref="PDB:4NO3"
FT                   /db_xref="PDB:4NO5"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="PDB:4QOK"
FT                   /db_xref="PDB:4U6X"
FT                   /db_xref="PDB:4U6Y"
FT                   /db_xref="PDB:4UQ3"
FT                   /db_xref="PDB:4WJ5"
FT                   /db_xref="PDB:4WUU"
FT                   /db_xref="PDB:4ZEZ"
FT                   /db_xref="PDB:5D2L"
FT                   /db_xref="PDB:5D2N"
FT                   /db_xref="PDB:5EU3"
FT                   /db_xref="PDB:5EU4"
FT                   /db_xref="PDB:5EU5"
FT                   /db_xref="PDB:5EU6"
FT                   /db_xref="PDB:5HHM"
FT                   /db_xref="PDB:5HHN"
FT                   /db_xref="PDB:5HHO"
FT                   /db_xref="PDB:5HHP"
FT                   /db_xref="PDB:5HHQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /protein_id="AAA76608.2"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <235..>1332
FT                   /product="HLA-A2"
FT                   /number=1
XX
SQ   Sequence 1332 BP; 261 A; 400 C; 429 G; 242 T; 0 other;
     aaggcggtgt atggattggg gagtcccagc cttggggatt ccccaactcc gcagtttctt        60
     ttctccctct cccaacctat gtagggtcct tcttcctgga tactcacgac gcggacccag       120
     ttctcactcc catcgggtgt cgggtttcca gagaagccaa tcagtgtcgt cgcggtcgcg       180
     gttctaaagt ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc       240
     gtcatggcgc cccgaaccct cgtcctgcta ctctcggggg ctctggccct gacccagacc       300
     tgggcgggct ctcactccat gaggtatttc ttcacatccg tgtcccggcc cggccgcggg       360
     gagccccgct tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg gttcgacagc       420
     gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga gggtccggag       480
     tattgggacg gggagacacg gaaagtgaag gcccactcac agactcaccg agtggacctg       540
     gggaccctgc gcggctacta caaccagagc gaggccggtt ctcacaccgt ccagaggatg       600
     tatggctgcg acgtggggtc ggactggcgc ttcctccgcg ggtaccacca gtacgcctac       660
     gacggcaagg attacatcgc cctgaaagag gacctgcgct cttggaccgc ggcggacatg       720
     gcagctcaga ccaccaagca caagtgggag gcggcccatg tggcggagca gttgagagcc       780
     tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg       840
     ctgcagcgca cggacgcccc caaaacgcat atgactcacc acgctgtctc tgaccatgaa       900
     gccaccctga ggtgctgggc cctgagcttc taccctgcgg agatcacact gacctggcag       960
     cgggatgggg aggaccagac ccaggacacg gagctcgtgg agaccaggcc tgcaggggat      1020
     ggaaccttcc agaagtgggc ggctgtggtg gtgccttctg gacaggagca gagatacacc      1080
     tgccatgtgc agcatgaggg tttgcccaag cccctcaccc tgagatggga gccgtcttcc      1140
     cagcccacca tccccatcgt gggcatcatt gctggcctgg ttctctttgg agctgtgatc      1200
     actggagctg tggtcgctgc tgtgatgtgg aggaggaaga gctcagatag aaaaggaggg      1260
     agctactctc aggctgcaag cagtgacagt gcccagggct ctgatgtgtc tctcacagct      1320
     tgtaaagtgt ga                                                          1332
//