Dbfetch

ID   U02561; SV 1; linear; genomic DNA; STD; HUM; 247 BP.
XX
AC   U02561;
XX
DT   01-JAN-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human class II HLA-DRB1*14 gene, exon 2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-247
RX   DOI; 10.1111/j.1399-0039.1994.tb02349.x.
RX   PUBMED; 7940503.
RA   Fogdell A., Olerup O.;
RT   "A novel DRB1 allele (DRB1*1415) formed by interallelic crossing over
RT   between the DRB1*1404 and the DRB1*0802 or 0804 alleles";
RL   Tissue Antigens 43(5):327-329(1994).
XX
RN   [2]
RP   1-247
RA   Fogdell A.C.;
RT   ;
RL   Submitted (18-OCT-1993) to the INSDC.
RL   Anna C Fogdell MS, NOVUM, Center for Biotechnology, Karolinska Institute,
RL   Huddinge, S-141 57, Sweden
XX
DR   MD5; f604a735f1469798ba8901c0bd2d202f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..247
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /haplotype="DRB1*14,DRB3*0202,DQA1*0104,DQB1*0503"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   exon            1..247
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>247
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /note="allele=DRB1*14"
FT                   /db_xref="GOA:Q29632"
FT                   /db_xref="IMGT/HLA:DRB1*14:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29632"
FT                   /protein_id="AAA53174.1"
FT                   /translation="STGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGR
FT                   PDAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQ"
XX
SQ   Sequence 247 BP; 52 A; 58 C; 90 G; 47 T; 0 other;
     ctctacgggt gagtgttatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata        60
     cttccataac caggaggagt tcgtgcgctt cgacagcgac gtgggggagt accgggcggt       120
     gacggagctg gggcggcctg atgccgagta ctggaacagc cagaaggact tcctggaaga       180
     caggcgggcc ctggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac       240
     agtgcag                                                                 247
//