spacer

EBI Dbfetch

ID   U01848; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U01848;
XX
DT   23-NOV-1993 (Rel. 37, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*1517 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1111/j.1399-0039.1994.tb02327.x.
RX   PUBMED; 7521976.
RA   Hildebrand W.H., Domena J.D., Shen S.Y., Lau M., Terasaki P.I., Bunce M.,
RA   Marsh S.G., Guttridge M.G., Bias W.B., Parham P.;
RT   "HLA-B15: a widespread and diverse family of HLA-B alleles";
RL   Tissue Antigens 43(4):209-218(1994).
XX
RN   [2]
RP   1-1089
RA   Domena J.D.;
RT   ;
RL   Submitted (15-SEP-1993) to the INSDC.
RL   John D. Domena, Department of Cell Biology, Stanford University, Sherman
RL   Fairchild Bldg., Stanford, CA 94305-5400 USA
XX
DR   MD5; b937e4d5f222d3cd4e2bad776b487191.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA A2/26; B38/63; Cw7/-"
FT                   /clone="18.2; 18.6; 19.1; 19.2"
FT                   /cell_line="JAP-NF"
FT                   /cell_type="EBV-transformed B-cell"
FT                   /db_xref="taxon:9606"
FT   gene            1..1089
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1517"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1517"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q31602"
FT                   /db_xref="H-InvDB:HIT000217427.14"
FT                   /db_xref="IMGT/HLA:B*15:17:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q31602"
FT                   /protein_id="AAA50577.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 218 A; 339 C; 362 G; 170 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacggaac atgaaggcct ccgcgcagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta ccaccaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer