spacer

EBI Dbfetch

ID   X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP.
XX
AC   X56734; S46826;
XX
DT   12-SEP-1991 (Rel. 29, Created)
DT   25-NOV-2005 (Rel. 85, Last updated, Version 11)
XX
DE   Trifolium repens mRNA for non-cyanogenic beta-glucosidase
XX
KW   beta-glucosidase.
XX
OS   Trifolium repens (white clover)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium.
XX
RN   [5]
RP   1-1859
RX   DOI; 10.1007/BF00039495.
RX   PUBMED; 1907511.
RA   Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.;
RT   "Nucleotide and derived amino acid sequence of the cyanogenic
RT   beta-glucosidase (linamarase) from white clover (Trifolium repens L.)";
RL   Plant Mol. Biol. 17(2):209-219(1991).
XX
RN   [6]
RP   1-1859
RA   Hughes M.A.;
RT   ;
RL   Submitted (19-NOV-1990) to the INSDC.
RL   Hughes M.A., University of Newcastle Upon Tyne, Medical School, Newcastle
RL   Upon Tyne, NE2 4HH, UK
XX
DR   MD5; 1e51ca3a5450c43524b9185c236cc5cc.
DR   EuropePMC; PMC99098; 11752244.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1859
FT                   /organism="Trifolium repens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10"
FT                   /clone="TRE361"
FT                   /tissue_type="leaves"
FT                   /db_xref="taxon:3899"
FT   mRNA            1..1859
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             14..1495
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="non-cyanogenic"
FT                   /db_xref="GOA:P26204"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26204"
FT                   /protein_id="CAA40058.1"
FT                   /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFI
FT                   FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMK
FT                   DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQ
FT                   VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGR
FT                   CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLD
FT                   DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDF
FT                   IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQ
FT                   EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSA
FT                   IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD"
XX
SQ   Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other;
     AAACAAACCA AATATGGATT TTATTGTAGC CATATTTGCT CTGTTTGTTA TTAGCTCATT        60
     CACAATTACT TCCACAAATG CAGTTGAAGC TTCTACTCTT CTTGACATAG GTAACCTGAG       120
     TCGGAGCAGT TTTCCTCGTG GCTTCATCTT TGGTGCTGGA TCTTCAGCAT ACCAATTTGA       180
     AGGTGCAGTA AACGAAGGCG GTAGAGGACC AAGTATTTGG GATACCTTCA CCCATAAATA       240
     TCCAGAAAAA ATAAGGGATG GAAGCAATGC AGACATCACG GTTGACCAAT ATCACCGCTA       300
     CAAGGAAGAT GTTGGGATTA TGAAGGATCA AAATATGGAT TCGTATAGAT TCTCAATCTC       360
     TTGGCCAAGA ATACTCCCAA AGGGAAAGTT GAGCGGAGGC ATAAATCACG AAGGAATCAA       420
     ATATTACAAC AACCTTATCA ACGAACTATT GGCTAACGGT ATACAACCAT TTGTAACTCT       480
     TTTTCATTGG GATCTTCCCC AAGTCTTAGA AGATGAGTAT GGTGGTTTCT TAAACTCCGG       540
     TGTAATAAAT GATTTTCGAG ACTATACGGA TCTTTGCTTC AAGGAATTTG GAGATAGAGT       600
     GAGGTATTGG AGTACTCTAA ATGAGCCATG GGTGTTTAGC AATTCTGGAT ATGCACTAGG       660
     AACAAATGCA CCAGGTCGAT GTTCGGCCTC CAACGTGGCC AAGCCTGGTG ATTCTGGAAC       720
     AGGACCTTAT ATAGTTACAC ACAATCAAAT TCTTGCTCAT GCAGAAGCTG TACATGTGTA       780
     TAAGACTAAA TACCAGGCAT ATCAAAAGGG AAAGATAGGC ATAACGTTGG TATCTAACTG       840
     GTTAATGCCA CTTGATGATA ATAGCATACC AGATATAAAG GCTGCCGAGA GATCACTTGA       900
     CTTCCAATTT GGATTGTTTA TGGAACAATT AACAACAGGA GATTATTCTA AGAGCATGCG       960
     GCGTATAGTT AAAAACCGAT TACCTAAGTT CTCAAAATTC GAATCAAGCC TAGTGAATGG      1020
     TTCATTTGAT TTTATTGGTA TAAACTATTA CTCTTCTAGT TATATTAGCA ATGCCCCTTC      1080
     ACATGGCAAT GCCAAACCCA GTTACTCAAC AAATCCTATG ACCAATATTT CATTTGAAAA      1140
     ACATGGGATA CCCTTAGGTC CAAGGGCTGC TTCAATTTGG ATATATGTTT ATCCATATAT      1200
     GTTTATCCAA GAGGACTTCG AGATCTTTTG TTACATATTA AAAATAAATA TAACAATCCT      1260
     GCAATTTTCA ATCACTGAAA ATGGTATGAA TGAATTCAAC GATGCAACAC TTCCAGTAGA      1320
     AGAAGCTCTT TTGAATACTT ACAGAATTGA TTACTATTAC CGTCACTTAT ACTACATTCG      1380
     TTCTGCAATC AGGGCTGGCT CAAATGTGAA GGGTTTTTAC GCATGGTCAT TTTTGGACTG      1440
     TAATGAATGG TTTGCAGGCT TTACTGTTCG TTTTGGATTA AACTTTGTAG ATTAGAAAGA      1500
     TGGATTAAAA AGGTACCCTA AGCTTTCTGC CCAATGGTAC AAGAACTTTC TCAAAAGAAA      1560
     CTAGCTAGTA TTATTAAAAG AACTTTGTAG TAGATTACAG TACATCGTTT GAAGTTGAGT      1620
     TGGTGCACCT AATTAAATAA AAGAGGTTAC TCTTAACATA TTTTTAGGCC ATTCGTTGTG      1680
     AAGTTGTTAG GCTGTTATTT CTATTATACT ATGTTGTAGT AATAAGTGCA TTGTTGTACC      1740
     AGAAGCTATG ATCATAACTA TAGGTTGATC CTTCATGTAT CAGTTTGATG TTGAGAATAC      1800
     TTTGAATTAA AAGTCTTTTT TTATTTTTTT AAAAAAAAAA AAAAAAAAAA AAAAAAAAA       1859
//



spacer
spacer