spacer

EBI Dbfetch

ID   S48645; SV 1; linear; mRNA; STD; HUM; 282 BP.
XX
AC   S48645;
XX
DT   16-FEB-1993 (Rel. 34, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   HLA-DRB1 (DRw12)=MHC class II antigen {first domain} [human, mRNA Partial,
DE   282 nt].
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 118459] from the original journal article.
RP   1-282
RX   DOI; 10.1016/0198-8859(92)90041-K.
RX   PUBMED; 1358866.
RA   O'Brien R.M., Cram D.S., Russ G.R., Starr R., Tait B.D.;
RT   "Nucleotide sequences of the HLA-DRw12 and DRw8 B1 chains from an
RT   Australian aborigine";
RL   Hum. Immunol. 34(2):147-151(1992).
XX
DR   MD5; a319452223f2fc0417e16415498aab40.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>282
FT                   /gene="HLA-DRB1"
FT                   /allele="DRw12"
FT                   /note="MHC class II antigen"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="DRw12"
FT                   /note="MHC class II antigen; mismatch(22[G->E]) in paper"
FT                   /db_xref="GOA:Q95465"
FT                   /db_xref="IMGT/HLA:DRB1*12:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95465"
FT                   /protein_id="AAB24005.2"
FT                   /translation="GDTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVG
FT                   EFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 282 BP; 59 A; 69 C; 103 G; 51 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgggtg agtgttattt cttcaatggg        60
     acggagcggg tgcggttact ggagagacac ttccataacc aggaggagct cctgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctgt cgccgagtcc       180
     tggaacagcc agaaggacat cctggaagac aggcgggccg cggtggacac ctattgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc ga                          282
//


spacer
spacer