Dbfetch

ID   MF946654; SV 1; linear; genomic DNA; STD; HUM; 3323 BP.
XX
AC   MF946654;
XX
DT   09-APR-2018 (Rel. 136, Created)
DT   09-APR-2018 (Rel. 136, Last updated, Version 1)
XX
DE   Homo sapiens isolate sz-26 MHC class I antigen (HLA-B) gene, HLA-B*40:01:45
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3323
RA   Gao S.;
RT   "Full-length sequence of a novel allele HLA-B in the Chinese population";
RL   Unpublished.
XX
RN   [2]
RP   1-3323
RA   Gao S.;
RT   ;
RL   Submitted (11-SEP-2017) to the INSDC.
RL   Shenzhen Institute of Transfusion Medicine, Shenzhen Blood Center, Nigang
RL   West Road, Meigang South Street No. 2, Futian District, Shenzhen, Guangdong
RL   518001, China
XX
DR   MD5; 4f96214e80720d02199ccf8547671b7b.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3323
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="sz-26"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /collection_date="Mar-2017"
FT                   /clone="Takara"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT   mRNA            join(<1..357,486..755,1001..1276,1851..2126,2220..2336,
FT                   2778..2810,2917..>3323)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /product="MHC class I antigen"
FT   exon            <1..357
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=1
FT   5'UTR           <1..284
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT   CDS             join(285..357,486..755,1001..1276,1851..2126,2220..2336,
FT                   2778..2810,2917..2960)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C6K6H8"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:C6K6H8"
FT                   /protein_id="AVU04902.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   intron          358..485
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=1
FT   exon            486..755
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=2
FT   intron          756..1000
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=2
FT   exon            1001..1276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=3
FT   intron          1277..1850
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=3
FT   exon            1851..2126
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=4
FT   intron          2127..2219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=4
FT   exon            2220..2336
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=5
FT   intron          2337..2777
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=5
FT   exon            2778..2810
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=6
FT   intron          2811..2916
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=6
FT   exon            2917..>3323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
FT                   /number=7
FT   3'UTR           2961..>3323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:01:45"
XX
SQ   Sequence 3323 BP; 615 A; 964 C; 1047 G; 695 T; 2 other;
     gatcaggacg aagtcccagg ccccgggcgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcaat ggggaggcgc agcgttgggg attccccact cccacgagtt tcacttcttc       120
     tcccaaccta tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc       180
     ccattgggtg tcgggtgtct agagaagcca atcagcgtcg ccgtggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcac       300
     cccgaaccgt cctcctactg ctctcggcgg ccctggccct gaccgagacc tgggccggtg       360
     agtgcgggtc ggcagggaaa tggcctctgt ggggaggagc gaggggaccg caggcggggg       420
     cgcaggaccc ggggagccgc gccgggagga gggtcgggcg ggtctcagct cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcca caccgccatg tcccggcccg gccgcgggga       540
     gccccgcttc atcaccgtgg gctacgtgga cgacacgctg ttcgtgaggt tcgacagcga       600
     cgccacgagt ccgaggaagg agccgcgggc gccatggata gagcaggagg ggccggagta       660
     ttgggaccgg gagacacaga tctccaagac caacacacag acttaccgag agagcctgcg       720
     gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgaccccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg ggactgggct gaccgcgggg ccggggccag ggtctcacac cctccagagg      1020
     atgtacggct gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc      1080
     tacgacggca aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac      1140
     acggcggctc agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga      1200
     gcctacctgg agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac      1260
     aagctggagc gcgctggtac caggggcagt ggggagcctt ccccatctcc tataggtcgc      1320
     cggggatggc ctcccacgag aagaggagga aaatgggatc agcgctagaa tgtcgccctc      1380
     cgttgaatgg agaatggcat gagttttcct gagtttcctc tgagggcccc ctcttctctc      1440
     tagacaatta aggaatgacg tctctgagga aatggagggg aagacagtcc ctagaatact      1500
     gatcaggggt cccctttgac ccctgcagca gccttgggaa ccgtgacttt tcctctcagg      1560
     ccttgttctc tgcctcacac tcagtgtgtt tggggctctg attccagcac ttctgagtca      1620
     ctttacctcc actcagatca ggagcagaag tccctgttcc ccgctcagag actcgaactt      1680
     tccaatgaat aggagattat cccaggtgcc tgcgtccagg ctggtgtctg ggttctgtgc      1740
     cccttcccca ccccaggtgt cctgtccatt ctcaggctgg tcacatgggt ggtcctaggg      1800
     tgtcccatga aagatgcaaa gcgcctgaat tttctgactc ttcccatcag accccccaaa      1860
     gacacacgtg acccaccacc ccatctctga ccatgaggcc accctgaggt gctgggccct      1920
     gggtttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg accaaactca      1980
     ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga agtgggcagc      2040
     tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc atgaggggct      2100
     gccgaagccc ctcaccctga gatggggtaa ggagggggat gaggggtcat atctcttctc      2160
     agggaaagca ggagcccttc agcagggtca gggcccctca tcttcccctc ctttcccaga      2220
     gccgtcttcc cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc      2280
     agttgtggtc atcggagctg tggtcgctgc tgtgatgtgt aggaggaaga gttcaggtag      2340
     ggaaggggtg aggggtgggg tctgggtttt cttgtcccac tgggggtttc aagccccagg      2400
     tagaagtgtt ccctgcctca ttactgggaa gcagcatgca cacaggggct aacgcagcct      2460
     gggaccctgt gtgccagcac ttactctttt gtgcagcaca tgtgacaatg aaggatggat      2520
     gtatcacctt gatggttgtg gtgttggggt cctgattcca gcattcatga gtcaggggaa      2580
     ggtccctgct aaggacagac cttaggaggg cagttggtcc aggacccaca cttgctttcc      2640
     tcgtgtttcc tgatcctgcc ctgggtctgt agtcatactt ctggaaattc cttttgggtc      2700
     caagactagg aggttcctct aagatctcat ggccctgctt cctcccagtg ccctcacagg      2760
     acattttctt cccacaggtg gaaaaggagg gagctactct caggctgcgt gtaagtggtg      2820
     ggggtgggag tgtggaggag ctcacccacc ccataattcc tcctgtccca cgtctcctgc      2880
     gggctctgac caggtcctgt ttttgttcta ctccaggcag cgacagtgcc cagggctctg      2940
     atgtgtctct cacagcttga aaaggtgaga ttcttggggt ctagagtggg tggggtggcg      3000
     ggtctggggg kgggkggggc agaggggaaa ggcctgggta atggggattc tttgattggg      3060
     atgtttcgcg tgtgtggtgg gctgtttaga gtgtcatcgc ttaccatgac taaccagaat      3120
     ttgttcatga ctgttgtttt ctgtagcctg agacagctgt cttgtgaggg actgagatgc      3180
     aggatttctt cacgcctccc ctttgtgact tcaagagcct ctggcatctc tttctgcaaa      3240
     ggcacctgaa tgtgtctgcg tccctgttag cataatgtga ggaggtggag agacagccca      3300
     cccttgtgtc cactgtgacc cct                                              3323
//