Dbfetch

ID   MF924374; SV 1; linear; genomic DNA; STD; HUM; 5846 BP.
XX
AC   MF924374;
XX
DT   15-MAR-2018 (Rel. 136, Created)
DT   15-MAR-2018 (Rel. 136, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (DQB1) gene, DQB1*06var allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5846
RA   Rudilla F.IV.;
RT   ;
RL   Submitted (07-SEP-2017) to the INSDC.
RL   Laboratori Histocompatibilitat i Immunogenetica, Banc de Sang i Teixits,
RL   Passeig Taulat, 106-116, Barcelona, Catalunya 08005, Spain
XX
DR   MD5; ededf3fb6b71b185bda18f41424641ec.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: GenDx v. v. 2.6.0.9001
CC   Sequencing Technology :: Sanger dideoxy sequencing; Illumina
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5846
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>5846
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT   mRNA            join(<1..177,1620..1889,4423..4704,5210..5320,5804..>5827)
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /product="MHC class II antigen"
FT   exon            <1..177
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /number=1
FT   5'UTR           <1..68
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT   CDS             join(69..177,1620..1889,4423..4704,5210..5320,5804..>5827)
FT                   /codon_start=1
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0A2P1DTP3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P1DTP3"
FT                   /protein_id="AVK71659.1"
FT                   /translation="MSWKKALRIPGGLRAPTVTLMLAMLSTPVAEGRDPPEDFVLQFKA
FT                   MCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAVTPQGRPDAEYWNSQKDILERTR
FT                   AELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRW
FT                   FWNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQSPITVEWRA
FT                   QSESAQNKMLSGIGGFVLGLIFLGLGLIIRQRSQKGPQGPPPA"
FT   exon            1620..1889
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /number=2
FT   exon            4423..4704
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /number=3
FT   exon            5210..5320
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /number=4
FT   exon            5804..>5827
FT                   /gene="DQB1"
FT                   /allele="DQB1*06var"
FT                   /number=5
XX
SQ   Sequence 5846 BP; 1508 A; 1315 C; 1432 G; 1591 T; 0 other;
     gccaggtaca tcagatccat caggtccgag ctgtgttgac taccactact tttccctttg        60
     tctcaattat gtcttggaag aaggctttgc ggatccccgg aggccttcgg gcaccaactg       120
     tgaccttgat gctggcgatg ctgagcaccc cagtggctga gggcagagac cctcccggta       180
     agtgcagggc agctgctctc cagagccgcc actctgggaa caggcattcc ttgggctggg       240
     gtagggggat ggtgatctcc atgatctcgg acacaatctt tcatcaacat ttcctctctt       300
     ttgggaaaga aagctatgtt gcattcccat ttatctttta gtgatgaggt gaggacaatc       360
     caatccccat cctacaggct taagcctgga agaagaggag agaggagagg aaagaggaga       420
     taaagtgtac atttactacc agtgatagga caaagtgagc atgggattat ttttgaaaat       480
     atgaatttct ccaaagacac agcaggattt gccgtttagg cgtgccccaa gattttgcct       540
     ggactaaata ttatgggatc ctgcattggg aaatacaagg cagcaatgat gtctgtagtc       600
     tccgtatttg aggaaaatta gtctgtattc ccaactgact ggagcgtttg tggaggcaaa       660
     atcttggtac tgagggaagc tgactggctg accacagaga gggagtcttc aggtttcact       720
     gatttatggg caaatggtga cttgagtggg attcagaggc ccgagttgat ggtggactaa       780
     atttagaaga aaggaggatg caaagagggg aaataacaca attgtgaaac cactcacttc       840
     agacacagaa caatacttta tgtaaattct ctctccttct aacatcctgt gtgtagatat       900
     catgattttc ctttacacaa ttatacttgt gatatggata ttctgttaca taacctgctc       960
     aagctggtga ctgccacagt ttaattggaa tctagtttat caaattcaaa agcttgtgct      1020
     ctttccatga ataaatgttt ctatctagga ctcagaggtg taggtccttt ctaacataga      1080
     agggagtgaa cctcaacggg acttggtagg gtaaatccag gcatgggaag gaaggtattt      1140
     tacccaggga ccaagagaat acgcgtatca gaacgaggac aggcttaatt cctggacctg      1200
     tctcgtcatt cccttgaact ctcaagtttt tgtggattaa ctatatctct gaggtatcca      1260
     ggagcttcat gaaaaatggg atttcatgcg agaacgccct gatccctcta agtgtagagg      1320
     tccatgtaaa atcagcccga ctgcctcttc gctgagttca ctggctcagg cagggacagg      1380
     gctttcctcc ctttcctggc tgtaggaagg cagattcccg aagcccccag agagggcggg      1440
     cagggctgag cagagccgcc gggaggatcc cagttctgga gcgccagaca cgggcaggcg      1500
     ggaactggag gtcgcgcggg cggttccaca gctccgggcc gggtcagggc ggcggctgcg      1560
     ggggcggccg ggctagggcc aggctggggc ctgactgacc ggccggtgat tccccgcaga      1620
     ggatttcgtg ctccagttta aggccatgtg ctacttcacc aatgggacgg agcgcgtgcg      1680
     ttatgtgacc agatacatct ataaccgaga ggaggacgtg cgcttcgaca gcgacgtggg      1740
     ggtgtatcgg gcggtgacgc cgcaggggcg gcctgacgcc gagtactgga acagccagaa      1800
     ggacatcctg gagaggaccc gagcggagtt ggacacggtg tgcagacaca actacgaggt      1860
     ggcgttccgc gggatcttgc agaggagagg tgagcgtggt tgaccctccg tgaggcgcac      1920
     ccttggccgg gaccccgagt ctctgtgccg ggaggggcga tgggggcgcg gcctctgaaa      1980
     tctgagcctc gttcattcca cgccaggaga caggaggcgg cggagggggt ggtgggggca      2040
     ggtgcaccgg aggagcgggg acctagggca gagcaggggg acaagcagag ttgactaggc      2100
     tgcctagtgt ccccccagcc tccccgtccg tcggcttcgt cctctgctct gcaggtttct      2160
     cgccttctgc cttgtgcgtt tgcctcctcg tgccttacct ttactaagca gttctctctg      2220
     cccccagtgc ccaccctctt cccctgcccg cctgccccgc tagtactgcc ccacccagca      2280
     aggcccacgt acgcagctcg cgcctcagga agcttcaggc ttggcctggt ggagttaggg      2340
     ctgccccaca actgcgctca gggcatccag caattacagt tgcgaaataa gatattttga      2400
     ctttttggct tcaaatcatt attcatcgta attctgtttt cttaaatggc tatcactcat      2460
     ggcggagatc tttgaggcga gagactgttt aattattgca tgcttggtac ctgacacatt      2520
     gactggtatg tggtatgagc tcaatgatct tccgttaaat tcatgaataa atgtactcag      2580
     ctgccaatcc atttaggttc gagaaaaaac agaggcttac aaatggactt aattaattac      2640
     tttctatcat tttgcttaat gcttcaaagt aaactcttat tgacttggat cttaatagaa      2700
     tttgtgaata caaagtctga ggaaaaaagt gtttgctaaa aataaaaaca gtgcttgaat      2760
     gatgttgtaa ggcagagttt taatttctta gaaaagctga acaaatggca caatgcaaag      2820
     agcagaagtt tgggaataaa taggttgaag ccattaaatt attggataaa aatagtttca      2880
     agttgctttt ggcctaggtt ctccccttcc cccatcacta tccacttcag gaataaacat      2940
     tctgaaagtc aattttaccc attcaggtgg cacttatttc tagacagttg ccttatcaaa      3000
     taccatatat gttatgtcat ttaatctcac agttacctgt gcattagaga ttagcatcac      3060
     cactttgtat atgctaatat tggtacatga taaacacttt aagtaatcaa cccacaatta      3120
     ctcaccaaga ccttaagcct cccaaagtat acaacattct tatgttcctc actgcacatc      3180
     tgtagagtct aagagatgta aggccttgtt aaagccagtt ttgaccagaa gcagcaatga      3240
     gtctattcct gtttgttctc catgttaatg gggcattgaa aattcactga ttaatcaatc      3300
     cctagtctga ccccagtgtt acctatgcag gttcacaaaa ctttcagttt actttatact      3360
     cccttgcctt cttttgactc acaacctaat gccagcaagt acttatattt ttgctatttc      3420
     agttctattt ccataaaatt tattttatca tcttttctca taaatttgcg ccctctattt      3480
     ttactcccag tctgtttaag atgaacaaat cttataaggc cacataggtg actgtgattt      3540
     cagttggact ccaggaagga gaacctgaag aaaagttcaa gtccaagcag aaactgtgat      3600
     ttcttccgga tgatggctca agagtgccgt ctaattgggg tgcaacctgc tgacctcagc      3660
     aaatcccagt tatatgtata tgttcacatt acaggctcat taacccaggc agacctctgc      3720
     acagatctca gaatattttc tatagagaac gtacatgata atgtctgatt tcagaacaag      3780
     aaagtaattc tcaataccaa ggaaatggag tggggtagac agctagtaat taaactcact      3840
     tgtgcgttaa aaagaaatta aggaaaaaaa gaaaatgaga gaacatatta ctaaataagg      3900
     aaagcacaca ttaaatattt gctatagttt cacactaaga gaataaagga aatgcaataa      3960
     agtggcctga aaagtaaagg atgagatgtg taaagaggcg gggaaagatg tgtcattttt      4020
     tttactatga gcagcaatct gagaagataa aggaatgggc aaacgtgatg tttgatcagt      4080
     gttatttgtt ttcaaggcct gcctactttt tttttcaaat attacaaatt tttgaagtaa      4140
     cattcttttt gttttttgct gtctgttact agattctata aagtaaattc tataaagtaa      4200
     attatgttac acattctata aaggcaggga ccatggtatg ttgtttatct ttggattctc      4260
     agtgattgtc aaatttatat ttgttgaatg aaccttgatc caagacttgg actccaggta      4320
     tctttccact ctggttccaa ggagggacct tcctcatggt ggacgtgctg tgtggtctca      4380
     catctcactc ctatgtcttt tcctgtctgt tactgccctc agtggagccc acagtgacca      4440
     tctccccatc caggacagag gccctcaacc accacaacct gctggtctgc tcggtgacag      4500
     atttctatcc aggccagatc aaagtccggt ggttttggaa tgaccaggag gagacagctg      4560
     gcgttgtgtc cacccccctt attaggaacg gtgactggac cttccagatc ctggtgatgc      4620
     tggaaatgac tccccagcat ggagacgtct acacctgcca cgtggagcac cccagcctcc      4680
     agagccccat caccgtggag tggcgtaagg ggatattgag tttctgttac tatgggcccc      4740
     acaagacaaa gagctccttc tgatccattc cttcccatct cttatccctg atgtcactac      4800
     tgagctggga atcacagaag actagacatc tcttgctcca tggcaagtgc atcagaagaa      4860
     tcctgatctc atcacctttc cagatgctag ggaaattact ctacgtactg ttgctctaga      4920
     tcccagtccc gacagctctc agggactgat tcttagggct ggtgattgag atcttagggt      4980
     ctaaggttat ggatgagttc ctgaggagca gagacttact tccctactct ctcacctact      5040
     cactgtatcc aaggacctat tggctttctc tcccttacgg gtggtctgaa tggaggacta      5100
     gcttcctttg acgccttcac ctcctgcacc tcagactgga cttcagctcc tcagcaggga      5160
     tgctatgggg tgtggagaca aacactgaca ctcaggctgt actccttagg ggctcagtct      5220
     gaatctgccc agaacaagat gctgagtggc attggaggct tcgtgctggg gctgatcttc      5280
     ctcgggctgg gccttatcat ccgtcaaagg agtcagaaag gtgaggaacc ctggaggaaa      5340
     aggggaagat gggctgcgac ccagaccctt tgttcagaga ggtcctgtct ttggacgtag      5400
     ctctttcctc ctgaccctga gaggaagaag gctaggctgg aggtgggagg agacaggaca      5460
     agattggaaa aggcattgga atctgatttt actggttgaa aggtagccct gtcacagagc      5520
     tgactgatag agcttattgc aggacaccct taccatttat cattgtctca ctggctcctt      5580
     tccaaaagct tcctccatta agagggtcag agcctcggcc tccttgcctt ctagtgaaaa      5640
     tttcctttgt tttaggggat tttaaattag ggtgcttaag gccttgaaga acatgggtgg      5700
     gaagagaata taactaatta agtcatgtgt gtcattttcc tttgggatga gagagtgtct      5760
     gtttgtgtaa tgagaccttt ctctgcataa cttccttttg taggacctca agggcctcca      5820
     ccagcaggta atatttcagc catgat                                           5846
//