Dbfetch

ID   MF801621; SV 1; linear; genomic DNA; STD; HUM; 1693 BP.
XX
AC   MF801621;
XX
DT   17-OCT-2017 (Rel. 134, Created)
DT   17-OCT-2017 (Rel. 134, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*26:01:xx new allele,
DE   exons 1 through 7 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1693
RA   Mostafa A.A., Khan F., Stamm L., Petrosenko M., Berka N.;
RT   "A novel HLA-A*26 allele identified by sequence-based typing in a bone
RT   marrow recipient";
RL   Unpublished.
XX
RN   [2]
RP   1-1693
RA   Mostafa A.A., Khan F., Stamm L., Petrosenko M., Berka N.;
RT   ;
RL   Submitted (01-SEP-2017) to the INSDC.
RL   Tissue Typing/Pathology, Calgary Laboratory Services, 9, 3535 Research Rd
RL   NW, Calgary, Alberta T2L 2K8, Canada
XX
DR   MD5; 036ea732a9ea5cdf5a34e05d074a53fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1693
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1693
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..>1693)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..>1693)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0A291NMV1"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A291NMV1"
FT                   /protein_id="ATJ00740.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACK"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1412
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=5
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   exon            1513..1545
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=6
FT   gap             1546..1645
FT                   /estimated_length=unknown
FT   exon            1646..>1693
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:01:xx new"
FT                   /number=7
XX
SQ   Sequence 1693 BP; 215 A; 328 C; 371 G; 179 T; 600 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacggaat gtgaaggccc actcacagac tgaccgagcg aacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag aggatgtatg gctgcgacgt ggggccggac gggcgcttcc       600
     tccgcgggta ccagcaggac gcttacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggagacgg       720
     cccatgaggc ggagcagtgg agagcctacc tggagggccg gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cgcccccaag acgcatatga ctcaccacgc tgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggga ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagc ccaccatccc      1320
     cattgtgggc atcattgctg gcctggttct ctttggagct gtgatcgctg gagctgtggt      1380
     cgctgctgtg atgtggagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnatagaaaa ggagggagct actctcaggc tgcaannnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnngcagt gacagtgccc agggctctga tatgtctctc      1680
     acagcttgta aag                                                         1693
//