Dbfetch

ID   MF797880; SV 1; linear; genomic DNA; STD; HUM; 2993 BP.
XX
AC   MF797880;
XX
DT   17-OCT-2017 (Rel. 134, Created)
DT   17-OCT-2017 (Rel. 134, Last updated, Version 1)
XX
DE   Homo sapiens isolate 15-3261 MHC class I antigen (HLA-C) gene, HLA-C*07
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2993
RA   Balas A.;
RT   "Sequence of two novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2993
RA   Balas A.;
RT   ;
RL   Submitted (31-AUG-2017) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia S/N, Madrid 28032, Spain
XX
DR   MD5; 284e479b81f3f98f31392f03273ec725.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2993
FT                   /organism="Homo sapiens"
FT                   /isolate="15-3261"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <26..>2928
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT   mRNA            join(<26..98,229..498,749..1024,1612..1887,2012..2131,
FT                   2572..2604,2712..2759,2924..>2928)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /product="MHC class I antigen"
FT   CDS             join(26..98,229..498,749..1024,1612..1887,2012..2131,
FT                   2572..2604,2712..2759,2924..2928)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6R739"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R739"
FT                   /protein_id="ATI97225.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
XX
SQ   Sequence 2993 BP; 559 A; 873 C; 946 G; 615 T; 0 other;
     actcacattc tccccagagg ccgagatgcg ggtcatggcg ccccgagccc tcctcctgct        60
     gctctcggga ggcctggccc tgaccgagac ctgggcctgt gagtgcgggg ttgggaggga       120
     agcggcctct gcggagagga gcgaggggcc ctcccggcga gggcgcagga cccggggagc       180
     cgcgcaggga ggtgggtcgg gcgggtctca gcccctcctc gcccccaggc tcccactcca       240
     tgaggtattt cgacaccgcc gtgtcccggc ccggccgcgg agagccccgc ttcatctcag       300
     tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agtccgagag       360
     gggagccgcg ggcgccgtgg gtggagcagg aggggccgga gtattgggac cgggagacac       420
     agaagtacaa gcgccaggca caggctgacc gagtgagcct gcggaacctg cgcggctact       480
     acaaccagag cgaggacggt gagtgacccc ggcccggggc gcaggtcacg acccctcccc       540
     atcccccacg gacggcccgg gtcgcccaga gtctccccgt ctgagatcca ccccaaggtg       600
     gatctgcgga acccgcccag accctcgacc ggagagagcc ccagtcgcct ttacccggtt       660
     tcattttcgg tttaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       720
     actgggctga ccgcgggggc ggggccaggg tctcacaccc tccagaggat gtctggctgc       780
     gacctggggc ccgacgggcg cctcctccgc gggtatgacc agtccgccta cgacggcaag       840
     gattacatcg ccctgaacga ggacctgcgc tcctggaccg ccgcggacac cgcggctcag       900
     atcacccagc gcaagttgga ggcggcccgt gcggcggagc agctgagagc ctacctggag       960
     ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc      1020
     gcaggtacca ggggcagtgg ggagccttcc ccatctccta tagatctccc gggatggcct      1080
     cccacgagga ggggaggaaa atgggatcag cactggaata tcgccctccc ttgaatggag      1140
     aatggcatga gttttcctga gtttcctctg agggccccct ctgctctcta ggacaattaa      1200
     gggatgaagt ctctgaggaa atggagggga agacagtccc tggaatactg atcaggggtc      1260
     tcctttgacc actttgacca ctgcagcagc tgtggtcagg ctgctgacct ttctctcagg      1320
     ccttgttctc tgcctcacac tcaatgtgtc tgaaggtttg attccagctt ttctgagtcc      1380
     tgcagcctcc actcaggtca ggaccagaag tcgctgttcc tccctcagag actagaactt      1440
     tccaatgaat aggagattat cccaggtgcc tgtgtccagg ctggcgtctg ggttctgtgc      1500
     cgccttcccc accccaggtg tcctgtccat tctcaggatg gtcacatggg cgctgctgga      1560
     gtgtcccaag agagatgcaa agtgtctgaa ttttctgact cttcccgtca gaacccccaa      1620
     agacacacgt gacccaccac cccctctctg accatgaggc caccctgagg tgctgggccc      1680
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccagaccc      1740
     aggacaccga gcttgtggag accaggccag caggagatgg aaccttccag aagtgggcag      1800
     ctgtggtggt gccttctgga caagagcaga gatacacgtg ccatatgcag cacgaggggc      1860
     tgcaagagcc cctcaccctg agctggggta aggaggggaa tggggggtca catctcttat      1920
     cagagaaagc agaagtcctt ctggagccct tcagccgggt cagggctgag gcttgggggt      1980
     cagggcccct caccttctcc tcctttccca gagccatctt cccagcccac catccccatc      2040
     atgggcatcg ttgctggcct ggctgtcctg gttgtcctag ctgtccttgg agctgtggtc      2100
     accgctatga tgtgtaggag gaagagctca ggtagggaag gggtgaagag cggggtctgg      2160
     gttttcttgt cccactggga gtttcaagcc ccaggtagaa gtgtgccccg ccttgttact      2220
     ggaagcacca tccacacatg ggccatccca gcctgggacc ctgtgtgcca gcacttactc      2280
     ttttgtgaag cacatgtgac aatgaaggac ggatgtatca ccttgatgat tatggtgttg      2340
     gggtcctgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg      2400
     agggcagttg gtccagaacc cacaactgct ttccccatgt ttcctgatcc tgccctgggt      2460
     ctgcagtcgt agttctggaa acttctcttg ggtccaagac taggaggttc ccctaagatc      2520
     acatggccct gcctcctccc agtcccctca tagggcattt tcttcccaca ggtggaaaag      2580
     gagggagctg ctctcaggct gcgtgtaagt gatggcggcg ggcgtgtgga ggagctcacc      2640
     tactccataa ttcctcttgt cccacatctc ctgcgggctc tgaccaggtc tttttttttg      2700
     ttctacccca ggcagcaaca gtgcccaggg ctctgatgag tctctcatca cttgtaaagg      2760
     tgagattctg gggagctgaa gtggtcgggg gtggggcaga gggaaaaggc ctgggtaatg      2820
     gggattcttt gattgggacg tttcgagtgt gtggtgggcc gttcagagtg tcatcgctta      2880
     ccatgactga cctgaatttg ttcatgacta ttgtgttctg tagcctgaga cagctgcctg      2940
     tgtgggactg agatgcagga tttcttcaca cctctccttt gtgacttcaa gag             2993
//