Dbfetch

ID   MF797879; SV 1; linear; genomic DNA; STD; HUM; 2970 BP.
XX
AC   MF797879;
XX
DT   17-OCT-2017 (Rel. 134, Created)
DT   17-OCT-2017 (Rel. 134, Last updated, Version 1)
XX
DE   Homo sapiens isolate 60788879 MHC class I antigen (HLA-A) gene, HLA-A*68
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2970
RA   Balas A.;
RT   "Sequence of two novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2970
RA   Balas A.;
RT   ;
RL   Submitted (31-AUG-2017) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia S/N, Madrid 28032, Spain
XX
DR   MD5; f28e53a42b62f59aa6d4ec693ca88eba.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2970
FT                   /organism="Homo sapiens"
FT                   /isolate="60788879"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <54..>2970
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT   mRNA            join(<54..126,257..526,768..1043,1644..1919,2019..2135,
FT                   2574..2606,2749..2796,2966..>2970)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT   CDS             join(54..126,257..526,768..1043,1644..1919,2019..2135,
FT                   2574..2606,2749..2796,2966..2970)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0A291NGJ9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A291NGJ9"
FT                   /protein_id="ATI97224.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMELRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 2970 BP; 580 A; 856 C; 919 G; 615 T; 0 other;
     ttctaaagtc cgcacgcacc caccgggact cagattctcc ccagacgccg aggatggccg        60
     tcatggcgcc ccgaaccctc gtcctgctac tctcgggggc cctggccctg acccagacct       120
     gggcgggtga gtgcggggtc gggagggaaa cggcctctgt ggggagaagc aaggggcccg       180
     cccggcgggg gcgcaggacc cgggaagccg cgcctggagg agggtcgggc gggtctcagc       240
     cactcctcgc ccccaggctc ccactccatg aggtatttct acacctccat gtcccggccc       300
     ggccgcgggg agccccgctt catcgccgtg ggctacgtgg acgacacgca gttcgtgcgg       360
     ttcgacagcg acgccgcgag ccagaggatg gagctgcggg cgccgtggat agagcaggag       420
     gggccggagt attgggaccg gaacacacgg aatgtgaagg cccagtcaca gactgaccga       480
     gtggacctgg ggaccctgcg cggctactac aaccagagcg aggccggtga gtgaccccgg       540
     cccggggcgc aggtcacgac ccctcatccc ccacggacgg gccaggtcgc ccacagtctc       600
     cgggtccgag atccgccccg aagccgcggg accccgagac ccttgccccg ggagaggccc       660
     aggcgccttt acccggtttc attttcagtt taggccaaaa atccccccgg gttggtcggg       720
     gcggggcggg gctcggggga ccgggctgac ctcggggtcc gggccaggtt ctcacaccat       780
     ccagaggatg tatggctgcg acgtggggcc ggacgggcgc ttcctccgcg ggtaccacca       840
     gtacgcctac gacggcaagg attacatcgc cctgaaagag gacctgcgct cttggaccgc       900
     ggcggacatg gcagctcaga ccaccaagca caagtgggag gcggcccatg tggcggagca       960
     gtggagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg      1020
     gaaggagacg ctgcagcgca cgggtaccag gggccacggg gcgcctccct gatcgcctgt      1080
     agatctcccg ggctggcctc ccacaaggag gggagacaat tgggaccaac actagaatat      1140
     cgccctccct ctggtcctga gggagaggaa tcctcctggg tttccagatc ctgtaccaga      1200
     gagtgactct gaggttccgc cctgctctct gacacaatta agggataaaa tctctgaagg      1260
     aatgacggga agacgatccc tcgaatactg atgagtggtt ccctttgaca cacacaggca      1320
     gcagccttgg gcccgtgact tttcctctca ggccttgttc tctgcttcac actcaatgtg      1380
     tgtgggggtc tgagtccagc acttctgagt ccctcagcct ccactcaggt caggaccaga      1440
     agtcgctgtt ccctcttcag ggactagaat tttccacgga ataggagatt atcccaggtg      1500
     cctgtgtcca ggctggtgtc tgggttctgt gctcccttcc ccatcccagg tgtcctgtcc      1560
     attctcaaga tagccacatg tgtgctggag gagtgtccca tgacagatgc aaaatgcctg      1620
     aatgatctga ctcttcctga cagacgcccc caaaacgcat atgactcacc acgctgtctc      1680
     tgaccatgaa gccaccctga ggtgctgggc cctgagcttc taccctgcgg agatcacact      1740
     gacctggcag cgggatgggg aggaccagac ccaggacacg gagctcgtgg agaccaggcc      1800
     tgcaggggat ggaaccttcc agaagtgggt ggctgtggtg gtgccttctg gacaggagca      1860
     gagatacacc tgccatgtgc agcatgaggg tttgcccaag cccctcaccc tgagatgggg      1920
     taaggaggga gacgggggtg tcatgtcttt tagggaaagc aggagcctct ctgaccttta      1980
     gcagggtcag ggcccctcac cttcccctct tttcccagag ccgtcttccc agcccaccat      2040
     ccccatcgtg ggcatcattg ctggcctggt tctctttgga gctgtgatca ctggagctgt      2100
     ggtcgctgct gtgatgtgga ggaggaagag ctcaggtggg gaaggggtga agggtgggtc      2160
     tgagatttct tgtctcactg agggttccaa gacccaggta gaagtgtgcc ctgcctcgtt      2220
     actgggaagc accacccaca attatgggcc tacccagcct gggccctgtg tgccagcact      2280
     tactcttttg taaagcacct gttaaaatga aggacagatt tatcaccttg attacagcgg      2340
     tgatgggacc tgatcccagc agtcacaagt cacaggggaa ggtccctgag gaccttcagg      2400
     agggcggttg gtccaggacc cacacctgct ttcttcatgt ttcctgatcc cgccctgggt      2460
     ctgcagtcac acatttctgg aaacttctct gaggtccaag acttggaggt tcctctagga      2520
     ccttaaggcc ctgactcctt tctggtatct cacaggacat tttcttccca cagatagaaa      2580
     aggagggagc tactctcagg ctgcaagtaa gtatgaagga ggctgatgcc tgaggtcctt      2640
     gggatattgt gtttgggagc ccatggggga gctcacccac cccacaattc ctcctctagc      2700
     cacatcttct gtgggatctg accaggttct gtttttgttc taccccaggc agtgacagtg      2760
     cccagggctc tgatgtgtct ctcacagctt gtaaaggtga gagcctggag ggcctgatgt      2820
     gtgttgggtg ttgggcggaa cagtggacac agctgtgcta tggggtttct ttccattgga      2880
     tgtattgagc atgcgatggg ctgtttaaag tgtgacccct cactgtgaca gatacgaatt      2940
     tgttcatgaa tatttttttc tatagtgtga                                       2970
//