Dbfetch

ID   MF795057; SV 1; linear; genomic DNA; STD; HUM; 3708 BP.
XX
AC   MF795057;
XX
DT   30-JUL-2018 (Rel. 137, Created)
DT   30-JUL-2018 (Rel. 137, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03:02 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3708
RA   Colom S., Masson D.;
RT   ;
RL   Submitted (01-SEP-2017) to the INSDC.
RL   Histocompatibility Laboratory, EFS of Grenoble, 29 Avenue Maquis du
RL   Gresivaudan, La Tronche 38701, France
XX
DR   MD5; 28db6780e59b5b9891f44a21c2d9896e.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Omixon HLA Twin v. 3.28.0.4
CC   Sequencing Technology :: Illumina
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3708
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3708
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:02 variant"
FT   mRNA            join(<1..270,2801..3082,3598..>3708)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:02 variant"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,2801..3082,3598..>3708)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:02 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0A345BIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A345BIJ6"
FT                   /protein_id="AXF50250.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQK"
FT   variation       3680
FT                   /gene="HLA-DQB1"
FT                   /replace="c"
XX
SQ   Sequence 3708 BP; 970 A; 851 C; 842 G; 1045 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag gtgagcgtcg tcgcccgtct gcgaggccca       300
     tccttggcag gggcccagag tctctgcgcc aggaggggcg aagggggcgc ggcctctgga       360
     acctgagcct tgttcgttcc accccggctg acaggaggag gcggtggggg tgctgggggc       420
     tggtgcatcg gaggggcagg gacctagggc agagcagggg gacaggcaga gttggtcaag       480
     ctgcctagtt tcgccccatc ctccccgtcc gtcggcctcg ccctctgctc tgcacgttct       540
     tgcctcgtgc cttatgcgtt tgcctcctcg tgccttacct ttactaagca gttctctctg       600
     cccccaattt ccgccctctt cccctgcccg cccgcccggc tagcactgcc gcacccggca       660
     aggtccacct acacagctca tgcagtggga agcttcagac ttggcctgat ggagttaggg       720
     ctgccccaca actgcgcgca gggcatccag caattacagt tgtcaaataa gatattttga       780
     cttttgactt caaattatta ttcatcgtaa ttctgttttc ttaaatggct ctcattcatg       840
     gcggagctct ttgagatgag agtgttttaa tcattgcatg cctggtatct gacacattga       900
     ctggcatgtg gtatgagctc aatgatcttc tgttaaatta atgaataaat gtgctcagct       960
     gccaatccac ttaggctcaa gggaaagcag aggataaata gagccttaaa aatggacttt      1020
     tattaattat tttctgtcat tttgcttaat tctttaaagt aaactcttat tgacttggat      1080
     cttaatagag tttgtgaata caaagtctga ggaaaaaagt gtttgctaaa aataaaaaca      1140
     acacttgaat gatgtttgta aggcagtttt aatttcttag aaaagctgaa caaatggcac      1200
     aatgcaaaga gcagaagttt tggaataaat agattgaagc aattaaatta ttggataaaa      1260
     atagtttcag gttgcttttg gcttaggttc tcccctcccc ccatcactat ccacttcagg      1320
     aataaacatt ctgaaagtca attttaccca tttagtgagc acttatttct agacagttac      1380
     cttatcaaat accgtctatg ttacgtcatt taatctcaca gttgcctgtg cattagagat      1440
     tagcatcacc actttatata tcctaatatt agtacatgac aaacacttta agtaatcagc      1500
     ccacaagtac tcaccaagac cttaagcctc ccaaagtaca caatattctt tatgttcttc      1560
     actacacatc tatagagtca aagggacata aagccttgtt aaagccagtt ttgactagaa      1620
     gcagcaatga gtctcttcct gtttgatctc catgttaatg ggacaaaatg atactttcaa      1680
     ggcattgaaa atttatgatt aatcaatccc tagtctgact ccagtgttac ctatgcagat      1740
     tcacaaaact tttagtttac tttaaactcc cttgccttct tttgactcac atcgtagtgc      1800
     cagcaagtac ttacattttt gctattttgg ttctatttcc ataaaattta ttttatcatc      1860
     ttttctcata agtttgtgcc ctctatttta ctcccagtct gtgtaagatg aacaaatctt      1920
     ataaggccac atagctgact gtgatttcag gtggactcca ggaaggagaa ccaaagaaaa      1980
     gttcaagtcc aagcagaaac cgtgattcct tccggatgat ggctcaagag tgccttttaa      2040
     ttggggtgca acctgctgac ctcagcaaat ctcagctata tttatatgtt cacattacag      2100
     gctcattaac ctaggctgat ctctgcaagg atctcagaat attttctaca gataacatac      2160
     atgataatat ctgatttcag gacaaaaaag taattctcaa tagcaaggga atggagtagg      2220
     gtagacagct agtaattaaa ctcacttgta tgttaaaaat aaattaagga aaaaaagaaa      2280
     atgagagaac atattactaa ataaagaaag catacattaa atatttacta tagtttcaca      2340
     ctaagagaat aaaggaaatg caataaagtg gcctgaaaga taaaggatga gacgtgtaaa      2400
     gagacaggga aagatgtgtc atttttttac tatgagcagc agtctgagaa gataaaggaa      2460
     tcgagttatg ggcaaacatg atgtttgatc agtgttattt gttttgaagg cctgcctact      2520
     tttgtttcaa atattacaga cttttgaaat cacattcttt ttgttttttg ctgtctgtta      2580
     ctagatcgca cattctgtaa aggcagggac catggtatgt tgtttatctt tggattctca      2640
     gtgattgtca tatttatatt tgttgaatga atcttaatcc aagacttgga ctccaggtat      2700
     ctttccactc tggttccaag gagggaccat tcccaatggt agacgtgctg tgtggtctca      2760
     catctcactc ctgtcttttc ctgtctgtta ctgccctcag tggagcccac agtgaccatc      2820
     tccccatcca ggacagaggc cctcaaccac cacaacctgc tggtctgctc agtgacagat      2880
     ttctatccag cccagatcaa agtccggtgg tttcggaatg accaggagga gacaactggc      2940
     gttgtgtcca ccccccttat taggaacggt gactggacct tccagatcct ggtgatgctg      3000
     gaaatgactc cccagcgtgg agacgtctac acctgccacg tggagcaccc cagcctccag      3060
     aaccccatca tcgtggagtg gcgtaagggg atattgagtt tctgttacta tgggccccac      3120
     aagacaaagg gcagagctcc ttctgaccca ttccttccca tctcttatcc ctgatgtcac      3180
     tactgagctg gggatcacag gagactagag cacctcttgc tccatggcaa gtgcatcaga      3240
     agaatcctga tctcatcacc tttccagatg ctagggaaat tattctacgt actgtttctc      3300
     cagatcccag tcctgatagc tcggagggac ttattattag ggctggtgac tgggatctta      3360
     gggtttaagg tatggatgag ttcctgagga gtggagatct gcttccccgc tctctcacct      3420
     actcactata ccgaaggacc tattggctgg ctttcccctc ccttaggggt ggtctgaatg      3480
     gaggactagg ttcctttgac actttcacct cctgcatctc agactggact tcagctcctc      3540
     agcagggatg ctatggggtg tagggacaaa cgctgacact caggctctgc ttcttagggg      3600
     ctcagtctga atctgcccag agcaagatgc tgagtggcat tggaggcttc gtgctggggc      3660
     tgatcttcct cgggctgggt cttattatcc atcacaggag tcagaaag                   3708
//