Dbfetch

ID   MF686924; SV 1; linear; genomic DNA; STD; HUM; 1717 BP.
XX
AC   MF686924;
XX
DT   30-JUL-2018 (Rel. 137, Created)
DT   30-JUL-2018 (Rel. 137, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51:90 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1717
RA   Bradshaw R.A.;
RT   ;
RL   Submitted (18-AUG-2017) to the INSDC.
RL   Transplant Lab, University Hospitals of Leicester, Transplant Lab,
RL   Leicester General Hospital, Gwendo, Gwendolen Road, Leicester,
RL   Leicestershire LE5 4PW, United Kingdom
XX
DR   MD5; 2dc31940470fa2edaa56984bbdd27541.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1717
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1717
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:90"
FT   mRNA            join(<76..345,591..866,1442..>1717)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:90"
FT                   /product="MHC class I antigen"
FT   CDS             join(<76..345,591..866,1442..>1717)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:90"
FT                   /product="MHC class I antigen"
FT                   /db_xref="UniProtKB/TrEMBL:A0A345BDY9"
FT                   /protein_id="AXF47911.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 1717 BP; 334 A; 536 C; 547 G; 300 T; 0 other;
     taggcggggg cgcaggacct gaggagccgc gccgggagga gggtcgggcg ggtctcagcc        60
     cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg       120
     gccgcgggga gccccgcttc attgcagtgg gctacgtgga cgacacccag ttcgtgaggt       180
     tcgacagcga cgccgcgagt ccgaggacgg agccccgggc gccatggata gagcaggagg       240
     ggccggagta ttgggaccgg aacacacaga tcttcaagac caacacacag acttaccgag       300
     agaacctgcg gatcgcgctc cgctactaca accagagcga ggccggtgag tgaccccggc       360
     ccggggcgca ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc       420
     gggtccgaga tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag       480
     ccccaggcgc gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc       540
     ggggcggggc ggggctcggg ggacggtgct gaccgcgggg ccggggccag ggtctcacac       600
     ttggcagacg atgtatggct gcgacgtggg gccggacggg cgcctcctcc gcgggcatga       660
     ccagtacgcc tacgacggca aagattacat cgccctgaac gaggacctga gctcctggac       720
     cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga       780
     gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagac acctggagaa       840
     cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt ccccatctcc       900
     tataggtcgc cggggatggc ctcccacgag aagaggagga aaatgggatc agcgctagaa       960
     tgtcgccctc ccttgaatgg agaatggcat gagttttcct gagtttcctc tgagggcccc      1020
     ctcttctctc taggacaatt aagggatgac gtctctgagg aaatggaggg gaagacagtc      1080
     cctagaatac tgatcagggg tcccctttga cccctgcagc agccttggga accgtgactt      1140
     ttcctctcag gccttgttct ctgcctcaca ctcagtgtgt ttggggctct gattccagca      1200
     cttctgagtc actttacctc cactcagatc aggagcagaa gtccctgttc cccgctcaga      1260
     gactcgaact ttccaatgaa taggagatta tcccaggtgc ctgcgtccag gctggtgtct      1320
     gggttctgtg ccccttcccc acaccaggtg tcctgtccat tctcaggctg gtcacatggg      1380
     tggtcctagg gtgtcccatg agagatgcaa agcgcctgaa ttttctgact cttcccatca      1440
     gaccccccaa agacacacgt gacccaccac cccgtctctg accatgaggc caccctgagg      1500
     tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag      1560
     gaccaaactc aggacactga gcttgtggag accagaccag caggagatag aaccttccag      1620
     aagtgggcag ctgtggtggt gccttctgga gaagagcaga gatacacatg ccatgtacag      1680
     catgaggggc tgccgaagcc cctcaccctg agatggg                               1717
//