spacer

EBI Dbfetch

ID   M99389; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   M99389;
XX
DT   28-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class I HLA heavy chain (HLA-Cw-0304) mRNA, complete cds.
XX
KW   class I gene; HLA class I heavy chain; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Domena J.D.;
RT   ;
RL   Unpublished.
XX
DR   MD5; b8597fe2ebfd47ad53dcf30d9deadd49.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="A24, 331; B51, 62; Cw3"
FT                   /cell_line="KRC 110"
FT                   /cell_type="EBV-transformed"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT                   /gene="HLA-Cw-0304"
FT                   /number=1
FT   gene            1..1101
FT                   /gene="HLA-Cw-0304"
FT   sig_peptide     1..24
FT                   /gene="HLA-Cw-0304"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-Cw-0304"
FT                   /product="HLA class I heavy chain"
FT                   /note="amino acid feature: glycosylated region, aa 86"
FT                   /db_xref="GOA:P04222"
FT                   /db_xref="H-InvDB:HIT000197033.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*03:04:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1EFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04222"
FT                   /protein_id="AAA88088.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   mat_peptide     25..1098
FT                   /gene="HLA-Cw-0304"
FT                   /product="HLA class I heavy chain"
FT   exon            74..343
FT                   /gene="HLA-Cw-0304"
FT                   /number=2
FT   exon            620..895
FT                   /gene="HLA-Cw-0304"
FT                   /number=3
FT   exon            896..1012
FT                   /gene="HLA-Cw-0304"
FT                   /number=5
FT   exon            1013..1101
FT                   /gene="HLA-Cw-0304"
FT                   /note="numbers 6-8"
XX
SQ   Sequence 1101 BP; 215 A; 330 C; 378 G; 178 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc tccgcgggta tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgaa gaatgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer