spacer

EBI Dbfetch

ID   M98436; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   M98436;
XX
DT   12-AUG-1992 (Rel. 33, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II protein (HLA-DRB1-11) gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1111/j.1399-0039.1993.tb02004.x.
RX   PUBMED; 8362413.
RA   Lin Y.N., Ren E.C., Chan S.H.;
RT   "A new DR11 allele in Singaporean Chinese";
RL   Tissue Antigens 41(4):204-205(1993).
XX
DR   MD5; d661dc3f599dc551cd866fac40f502cd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /cell_line="CCY"
FT                   /cell_type="lymphoblastoid cell line"
FT                   /tissue_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             1..255
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DRB1-11"
FT                   /product="MHC class II DR-beta-1"
FT                   /note="alternate allele"
FT                   /db_xref="GOA:Q05525"
FT                   /db_xref="IMGT/HLA:DRB1*11:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q05525"
FT                   /protein_id="AAA59693.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGAVESFT"
XX
SQ   Sequence 255 BP; 55 A; 59 C; 90 G; 51 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgtgc gcttcgacag cgacgtgggg       120
     gagttccggg cggtgacgga gctggggcgg cctgatgagg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccgcggtg gacacctact gcagacacaa ctacggggct       240
     gtggagagct tcaca                                                        255
//


spacer
spacer