spacer

EBI Dbfetch

ID   M94460; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   M94460;
XX
DT   20-FEB-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class II HLA DRB1 LEV gene, partial cds, (DR4).
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RX   DOI; 10.1111/j.1399-0039.1992.tb02057.x.
RX   PUBMED; 1481205.
RA   Petersdorf E.W., Smith A.G., Martin P.J., Hansen J.A.;
RT   "HLA-DRB1 first domain sequence for a novel DR4 allele designated
RT   DRB1*0413";
RL   Tissue Antigens 40(5):267-268(1992).
XX
DR   MD5; 3adce70bcebb9b02517e0741455e7425.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LEV"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB4"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:Q30123"
FT                   /db_xref="IMGT/HLA:DRB1*04:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30123"
FT                   /protein_id="AAA59779.1"
FT                   /translation="HECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPD
FT                   AEYWNSQKDLLEQKRAAVDTYCRHNYGVVESFT"
XX
SQ   Sequence 234 BP; 52 A; 58 C; 84 G; 40 T; 0 other;
     catgagtgtc atttcttcaa cgggacggag cgggtgcggt tcctggacag atacttctat        60
     caccaagagg agtacgtgcg cttcgacagc gacgtggggg agtaccgggc ggtgacggag       120
     ctggggcggc ctgatgccga gtactggaac agccagaagg acctcctgga gcagaagcgg       180
     gccgcggtgg acacctactg cagacacaac tacggggttg tggagagctt caca             234
//


spacer
spacer