spacer

EBI Dbfetch

ID   M91807; SV 1; linear; genomic DNA; STD; HUM; 219 BP.
XX
AC   M91807;
XX
DT   24-SEP-1992 (Rel. 33, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA-DR-beta-1 (HLA-DRB1) gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-219
RX   DOI; 10.1111/j.1399-0039.1992.tb02108.x.
RX   PUBMED; 1440569.
RA   Eberle M., Baxter-Lowe L.A.;
RT   "A silent mutation in HLA-DRB1*0301 can affect oligotyping";
RL   Tissue Antigens 40(3):150-152(1992).
XX
DR   MD5; 918ff7f1de39b1342c2c4758148d20e6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..219
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /lab_host="INV1-alpha-F"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>219
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta-1"
FT                   /db_xref="GOA:O19723"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19723"
FT                   /protein_id="AAA59790.1"
FT                   /translation="ECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDLLEQKRGRVDNYCRHNYGVV"
XX
SQ   Sequence 219 BP; 49 A; 50 C; 83 G; 37 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggtacc tggacagata cttccataac        60
     caggaggaga acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggacc tcctggagca gaagcggggc       180
     cgggtggaca attactgcag acacaactac ggggttgtg                              219
//


spacer
spacer