Dbfetch

ID   M84446; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   M84446;
XX
DT   03-FEB-1992 (Rel. 30, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human lymphocyte antigen DRB1 allele 08/12 (HLA-DRB1-08/12) gene, partial
DE   cds.
XX
KW   allelic variation; lymphocyte antigen-DRB1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1016/0198-8859(92)90081-W.
RX   PUBMED; 1399719.
RA   Eberle M., Baxter-Lowe L.A.;
RT   "Molecular analysis of HLA-DRB1*08/12 alleles: identification of two
RT   additional alleles";
RL   Hum. Immunol. 34(1):24-30(1992).
XX
DR   MD5; 5fe6207a3d27911f447a6589c647570f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..255
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>255
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="lymphocyte antigen DRB1-08/12"
FT                   /note="alternate allele"
FT                   /db_xref="GOA:Q29918"
FT                   /db_xref="IMGT/HLA:DRB1*08:04:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29918"
FT                   /protein_id="AAA59481.1"
FT                   /translation="YSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELG
FT                   RPDAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 255 BP; 55 A; 59 C; 93 G; 48 T; 0 other;
     gtactctacg ggtgagtgtt atttcttcaa tgggacggag cgggtgcggt tcctggacag        60
     atacttctat aaccaagagg agtacgtgcg cttcgacagc gacgtggggg agtaccgggc       120
     ggtgacggag ctggggcggc ctgatgccga gtactggaac agccagaagg acttcctgga       180
     agacaggcgg gccctggtgg acacctactg cagacacaac tacggggttg tggagagctt       240
     cacagtgcag cggcg                                                        255
//