Dbfetch

ID   M84382; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   M84382; M86402;
XX
DT   03-FEB-1992 (Rel. 30, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*1504 allele, complete
DE   cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1038/357326a0.
RX   PUBMED; 1317015.
RA   Belich M.P., Madrigal J.A., Hildebrand W.H., Zemmour J., Williams R.C.,
RA   Luz R., Petzl-Erler M.L., Parham P.;
RT   "Unusual HLA-B alleles in two tribes of Brazilian Indians";
RL   Nature 357(6376):326-329(1992).
XX
RN   [2]
RX   DOI; 10.1038/357329a0.
RX   PUBMED; 1589035.
RA   Watkins D.I., McAdam S.N., Liu X., Strang C.R., Milford E.L., Levine C.G.,
RA   Garber T.L., Dogon A.L., Lord C.I., Ghim S.H., Troup G.M., Hughes A.L.,
RA   Letvin N.L.;
RT   "New recombinant HLA-B alleles in a tribe of South American Amerindians
RT   indicate rapid evolution of MHC class I loci";
RL   Nature 357(6376):329-333(1992).
XX
DR   MD5; b4b511126442d9332425a46d351fd97b.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
CC   On Feb 8, 2002 this sequence version replaced gi:188476.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2 Cw3 Bw62 DR2 DQw1/A2 Cw3 B40 DRw6 DQw3"
FT                   /cell_line="GRC138"
FT                   /cell_type="EBV transformed cells"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30464"
FT                   /db_xref="H-InvDB:HIT000196571.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*15:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30464"
FT                   /protein_id="AAA59632.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     1..72
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT   misc_feature    25..1089
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT                   /citation=[2]
FT   mat_peptide     73..1086
FT                   /gene="HLA-B"
FT                   /product="lymphocyte antigen"
FT                   /note="G00-120-048"
XX
SQ   Sequence 1098 BP; 224 A; 337 C; 364 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagtgg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa agcctgag                                                    1098
//