spacer

EBI Dbfetch

ID   M84375; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   M84375; M86405;
XX
DT   08-FEB-1992 (Rel. 30, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens MHC class I antigen (HLA) mRNA, HLA-A*3101 allele, complete
DE   cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1038/357326a0.
RX   PUBMED; 1317015.
RA   Belich M.P., Madrigal J.A., Hildebrand W.H., Zemmour J., Williams R.C.,
RA   Luz R., Petzl-Erler M.L., Parham P.;
RT   "Unusual HLA-B alleles in two tribes of Brazilian Indians";
RL   Nature 357(6376):326-329(1992).
XX
RN   [2]
RX   DOI; 10.1038/357329a0.
RX   PUBMED; 1589035.
RA   Watkins D.I., McAdam S.N., Liu X., Strang C.R., Milford E.L., Levine C.G.,
RA   Garber T.L., Dogon A.L., Lord C.I., Ghim S.H., Troup G.M., Hughes A.L.,
RA   Letvin N.L.;
RT   "New recombinant HLA-B alleles in a tribe of South American Amerindians
RT   indicate rapid evolution of MHC class I loci";
RL   Nature 357(6376):329-333(1992).
XX
DR   MD5; 4e39aef86e7732aa376885bb3497198a.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
CC   On Feb 8, 2002 this sequence version replaced gi:188473.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2 Cw7 B39 DRw8 DQ_/A31 Cw4 B35 DRw8 DQ_"
FT                   /cell_line="KRC033"
FT                   /cell_type="EBV transformed cells"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /gene="HLA-A"
FT                   /note="G00-119-310"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P16189"
FT                   /db_xref="H-InvDB:HIT000196565.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*31:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16189"
FT                   /protein_id="AAA59599.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   mat_peptide     73..1095
FT                   /gene="HLA-A"
FT                   /product="lymphocyte antigen"
FT                   /note="G00-119-310"
XX
SQ   Sequence 1098 BP; 215 A; 328 C; 368 G; 187 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcacca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagat tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctc cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctagttct ctttggagct       960
     gtgttcgctg gagctgtggt cgctgctgtg aggtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer