Dbfetch

ID   M84173; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   M84173; M24029;
XX
DT   17-JUL-1992 (Rel. 32, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   Human MHC class I (HLA-Cw8.2) mRNA exons 1-7, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RX   PUBMED; 2715640.
RA   Parham P., Lawlor D.A., Lomen C.E., Ennis P.D.;
RT   "Diversity and diversification of HLA-A,B,C alleles";
RL   J. Immunol. 142(11):3937-3950(1989).
XX
RN   [2]
RP   1-1101
RX   DOI; 10.1111/j.1399-0039.1992.tb01943.x.
RX   PUBMED; 1384166.
RA   Zemmour J., Gumperz J.E., Hildebrand W.H., Ward F.E., Marsh S.G.,
RA   Williams R.C., Parham P.;
RT   "The molecular basis for reactivity of anti-Cw1 and anti-Cw3 alloantisera
RT   with HLA-B46 haplotypes";
RL   Tissue Antigens 39(5):249-257(1992).
XX
DR   MD5; 03c517eb4a716962066e68645c185b80.
DR   H-InvDB; HIT000196560_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="LWAGS"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:P30505"
FT                   /db_xref="H-InvDB:HIT000196560_02.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*08:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:4NT6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30505"
FT                   /protein_id="AAA59687.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="G00-119-311"
FT   exon            74..343
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="G00-119-311"
FT   exon            344..619
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="G00-119-311"
FT   exon            620..895
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="G00-119-311"
FT   exon            896..1015
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="G00-119-311"
FT   exon            1016..1048
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="G00-119-311"
FT   exon            1049..1101
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="G00-119-311"
XX
SQ   Sequence 1101 BP; 220 A; 337 C; 371 G; 173 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttctaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcagttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aatgaggacc tgcgctcctg gaccgccgcg       480
     gacaaggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     aagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccagagcccc tcaccctgag atgggggcca       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt gatggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//