spacer

EBI Dbfetch

ID   M84172; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   M84172;
XX
DT   17-JUL-1992 (Rel. 32, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class I (HLA-Cw3.2) mRNA exons 1-7, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RX   DOI; 10.1111/j.1399-0039.1992.tb01943.x.
RX   PUBMED; 1384166.
RA   Zemmour J., Gumperz J.E., Hildebrand W.H., Ward F.E., Marsh S.G.,
RA   Williams R.C., Parham P.;
RT   "The molecular basis for reactivity of anti-Cw1 and anti-Cw3 alloantisera
RT   with HLA-B46 haplotypes";
RL   Tissue Antigens 39(5):249-257(1992).
XX
DR   MD5; 8691748d2432af8ddd15be2c6cedd342.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="AP"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:P04222"
FT                   /db_xref="H-InvDB:HIT000196559.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*03:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1EFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04222"
FT                   /protein_id="AAA59686.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHILQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="G00-119-311"
FT   exon            74..343
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="G00-119-311"
FT   exon            344..619
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="G00-119-311"
FT   exon            620..895
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="G00-119-311"
FT   exon            896..1015
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="G00-119-311"
FT   exon            1016..1048
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="G00-119-311"
FT   exon            1049..1101
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="G00-119-311"
XX
SQ   Sequence 1101 BP; 214 A; 332 C; 377 G; 178 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcctccag       360
     aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgaa gaatgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagcca       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer