spacer

EBI Dbfetch

ID   M84014; SV 1; linear; genomic DNA; STD; HUM; 213 BP.
XX
AC   M84014;
XX
DT   03-FEB-1992 (Rel. 30, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II lymphocyte antigen (DP1 beta-chain) gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-213
RX   DOI; 10.1111/j.1399-0039.1992.tb01969.x.
RX   PUBMED; 1412416.
RA   Eiermann T.H., Uhl S., Fakler J., Goldmann S.F.;
RT   "A novel HLA-DPB1 sequence, DPB1*2301";
RL   Tissue Antigens 40(2):108-110(1992).
XX
DR   MD5; 6141df55a03bce2c7b1e70fee9c310d1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..213
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="Do2028915 (10th IHW # 9008)"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..213
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC HLA-DPB1"
FT                   /db_xref="GOA:Q29956"
FT                   /db_xref="IMGT/HLA:DPB1*23:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29956"
FT                   /protein_id="AAA59650.1"
FT                   /translation="QGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRP
FT                   AAEYWNSQKDILEEKRAVPDRMCRHN"
XX
SQ   Sequence 213 BP; 50 A; 50 C; 82 G; 31 T; 0 other;
     cagggacggc aggaatgcta cgcgtttaat gggacacagc gcttcctgga gagatacatc        60
     tacaaccggg aggagttcgt gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       120
     gagctggggc ggcctgctgc ggagtactgg aacagccaga aggacatcct ggaggagaag       180
     cgggcagtgc cggacaggat gtgcagacac aac                                    213
//


spacer
spacer