spacer

EBI Dbfetch

ID   M83913; SV 1; linear; genomic DNA; STD; HUM; 285 BP.
XX
AC   M83913;
XX
DT   28-JAN-1993 (Rel. 34, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC HLA DPB1 chain gene, exon 2, EBV transformed cell lines D0208915,
DE   BHA167, UK3082, UK5496.
XX
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-285
RA   Kimura A.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 1a632a9e9c3b638cf35b18500fe9cca4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..285
FT                   /organism="Homo sapiens"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="EBV-transformed D0208915, BHA167, UK3082,
FT                   UK5496"
FT                   /db_xref="taxon:9606"
FT   intron          <1..19
FT                   /number=1
FT   CDS             <20..>283
FT                   /codon_start=3
FT                   /product="MHC HLA DPB1"
FT                   /note="label:exon_2"
FT                   /db_xref="GOA:Q30056"
FT                   /db_xref="IMGT/HLA:DPB1*23:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30056"
FT                   /protein_id="AAA36265.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   intron          284..>285
FT                   /number=2
XX
SQ   Sequence 285 BP; 61 A; 78 C; 102 G; 44 T; 0 other;
     gtccgccccc tccccgcaga gaattacctt ttccagggac ggcaggaatg ctacgcgttt        60
     aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagtt cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctgc tgcggagtac       180
     tggaacagcc agaaggacat cctggaggag aagcgggcag tgccggacag gatgtgcaga       240
     cacaactacg agctgggcgg gcccatgacc ctgcagcgcc gaggt                       285
//


spacer
spacer