spacer

EBI Dbfetch

ID   M83193; SV 1; linear; mRNA; STD; HUM; 1017 BP.
XX
AC   M83193;
XX
DT   04-AUG-1992 (Rel. 33, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens (isolate HA) HLA-Bw62 antigen (HLA-Bw62.3 IEF variant, B*1501
DE   allele) mRNA, 3'end.
XX
KW   B*1501 allele; HLA-Bw62 antigen; HLA-Bw62.3 IEF variant.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1017
RX   DOI; 10.1007/BF00216833.
RX   PUBMED; 8423049.
RA   Choo S.Y., Fan L.-A., Hansen J.A.;
RT   "Allelic variations clustered in the antigen binding sites of HLA-Bw62
RT   molecules";
RL   Immunogenetics 37(2):108-113(1993).
XX
DR   MD5; b97cc90e13f33831e833ae930251514d.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1017
FT                   /organism="Homo sapiens"
FT                   /map="chromosome 6"
FT                   /host="HA"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1017
FT                   /gene="HLA-Bw62.3"
FT   CDS             1..1017
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-Bw62.3"
FT                   /product="HLA-Bw62 antigen"
FT                   /db_xref="GOA:P30464"
FT                   /db_xref="H-InvDB:HIT000196515.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*15:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30464"
FT                   /protein_id="AAA58628.1"
FT                   /translation="GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRM
FT                   APRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVG
FT                   PDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGL
FT                   CVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGE
FT                   DQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQST
FT                   IPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1017 BP; 213 A; 308 C; 337 G; 159 T; 0 other;
     ggctcccact ccatgaggta tttctacacc gccatgtccc ggcccggccg cggggagccc        60
     cgcttcatcg cagtgggcta cgtggacgac acccagttcg tgaggttcga cagcgacgcc       120
     gcgagtccga ggatggcgcc ccgggcgcca tggatagagc aggaggggcc ggagtattgg       180
     gaccgggaga cacagatctc caagaccaac acacagactt accgagagag cctgcggaac       240
     ctgcgcggct actacaacca gagcgaggcc gggtctcaca ccctccagag gatgtacggc       300
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcatg accagtccgc ctacgacggc       360
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga cacggcggct       420
     cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagtggag agcctacctg       480
     gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       540
     cgcgcggacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc       600
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat       660
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc       720
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat       780
     gtacagcatg aggggctgcc gaagcccctc accctgagat gggagccatc ttcccagtcc       840
     accatcccca tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga       900
     gctgtggtcg ctactgtgat gtgtaggagg aagagctcag gtggaaaagg agggagctac       960
     tctcaggctg cgtccagcga cagtgcccag ggctctgatg tgtctctcac agcttga         1017
//


spacer
spacer