spacer

EBI Dbfetch

ID   M80470; SV 1; linear; genomic DNA; STD; HUM; 4745 BP.
XX
AC   M80470;
XX
DT   07-DEC-1991 (Rel. 30, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-J gene, exons 1-8 and partial cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   inactive antigen; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4745
RX   PUBMED; 1602142.
RA   Messer G., Zemmour J., Orr H.T., Parham P., Weiss E.H., Girdlestone J.;
RT   "HLA-J, a second inactivated class I HLA gene related to HLA-G and HLA-A.
RT   Implications for the evolution of the HLA-A-related genes";
RL   J. Immunol. 148(12):4043-4053(1992).
XX
DR   MD5; f9d31261591bafd42d440c5777414c13.
XX
CC   On May 19, 1995 this sequence version replaced gi:188485.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4745
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LCL 721"
FT                   /cell_type="lymphoblastiod"
FT                   /tissue_type="hematopoietic"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(535..604,735..1004,1252..1527,2123..2397,2520..2636,
FT                   3074..3106,3248..3295,3463..3467)
FT   exon            535..604
FT                   /number=1
FT   CDS             join(535..604,735..1004,1252..1527,2123..2161)
FT                   /partial
FT                   /codon_start=1
FT                   /product="MHC class I HLA-J antigen"
FT                   /db_xref="GOA:Q30175"
FT                   /db_xref="IMGT/HLA:J*02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q30175"
FT                   /protein_id="AAA66955.1"
FT                   /translation="MGSWRPEPSSCCSRDPALAETWAGSHSMRYFSTAVSWPGRGEPSF
FT                   IAVGYVDDTQFVRVDSDAVSLRMKTRARWVEQEGPEYWDLQTLGAKAQAQTDRVNLRTL
FT                   LRYYNQSEAGYHILQGMFGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADTAA
FT                   QITQRKYEAANVAEQRRAYLEGTCMEWLRRHLENGKETLQRADPPQDTRDPPPSL"
FT   exon            735..1004
FT                   /number=2
FT   exon            1252..1527
FT                   /number=3
FT   exon            2123..2397
FT                   /number=4
FT   exon            2520..2636
FT                   /number=5
FT   exon            3074..3106
FT                   /number=6
FT   exon            3248..3295
FT                   /number=7
FT   exon            3463..3467
FT                   /number=8
XX
SQ   Sequence 4745 BP; 979 A; 1272 C; 1373 G; 1119 T; 2 other;
     acctcattcc aggagctccc tctctggcac caagctccct ggggtgagtt ttctttttga        60
     agagtccagg agaacaggta agcagtgggg aagcagggag tccatttcag ggacaggaat       120
     tcccggatga aaagtgaaag gagagggacg gggcccaagc tgagggtttc ttcctggttt       180
     ctcggacagc tcctggacca agactcaggg aacattgaga cagagcgttt gtcacaggag       240
     gagcggggtc agggcgaagt cccagagccc caggcatggc tctcagggtc tcaggccccg       300
     aaggcggtgc atgggctggg gaggtgcagc attggggatt ccccatctcc gcagagtttc       360
     tcttctccct ctcccagcct gcgacgggtc cttcttcctg gacactcacg acgcggaccc       420
     agttctcact cccactgagt gtcgggtttc tagggaagcc aatcagcgtc gcgcggcccc       480
     ggttctaaag tccccacgca ccaccgggac tcggagtctc cccagacgcc gacgatgggg       540
     tcatggcgcc ccgaaccctc ctcctgctgc tctcgggacc ctgccctggc cgagacctgg       600
     gcgggtgagt gcggggtcag gagggaaacg gcctctgccg tgaggagcga aaggtccacc       660
     tggctggggc gcaggacccg gggagccgcg ccgggaggag ggtcgggcgg gtctcagccc       720
     ctcctcgccc ccaggctccc actccatgag gtatttcagc accgccgttt cctggccggg       780
     ccgcggggag cccagcttca ttgccgtggg ctacgtggac gacacgcagt tcgtgcgggt       840
     cgacagtgac gccgtgagtc tgaggatgaa gacgcgggcg cggtgggtgg agcaggaggg       900
     gccggagtat tgggacctac agacactggg cgccaaggcc caggcacaga ctgaccgagt       960
     gaacctgcgg accctgctcc gctactacaa ccagagcgag gcgggtgagt gaccccggcc      1020
     cggggcgcag atcacttact ccccgctcca tgcctcacgg acggccctgg tcccctgagt      1080
     ctccgggtcc aagatcgacc ccgaggctgc ggacctgcag agatcctcga cccgggagag      1140
     ccccaggcgc ctttacctgg tttcatcttc agttgaggcc aaaatctccg caggttgcta      1200
     gggtccgggc cagggctcgg tgggcggggc tgaccgcggg aactgggcca gggtatcaca      1260
     tcctccaggg aatgtttggc tgcgacctgg ggcccgacgg gcgtctcctc cgcgggtatg      1320
     agcagtatgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga      1380
     ccgccgcgga taccgcggct cagattaccc agcgcaagta tgaggcggcc aatgtggctg      1440
     agcaaaggag agcctacctg gagggcacct gcatggagtg gctccgcaga cacctggaga      1500
     acgggaagga gacgctgcag cgcgcgggta ccaggggcca tggggagcct gctcgatctc      1560
     ctgtagatct cccgggctgg cctcgcacaa ggaggggaag aaaatggaaa caccaccaga      1620
     atatcgccct ccctcctgtc ctgacggaga ggaatcctcc tgggtttcca gatcctgtat      1680
     cagagattga ctctgagggc ccaccctgct cttcctggga caattaaggg atgaagtctc      1740
     tgagggagtg gaggggaaga caatccctgg aagactgatc cgcggtcccc tttcacccca      1800
     cagcaacctt gggcaccagg acttttcctc ccgggccttg ttctctgcct cacactcaat      1860
     gtgtcggagt ctgactccag ctcctctgag tcccttggcc tccactcaga tcaggaccag      1920
     aagtccctgc taccctgctc agagactaga actttccaag gaataggaga ttatcccagg      1980
     cgcctgtgtc caggctggtg tctgggctct gtgctccctt ccccacccca ggtgtcctat      2040
     tcatcaggat ggtcacatgg gcgctgctgg ggtgtcccat gaggaatgca aagtgcctga      2100
     gttttccgac tcttcctttc agaccccccc caagacacac gtgacccacc cccctctctg      2160
     aacatgaggc ataacgaggt cctgggttct gggcttctac cctgcggaga tcacattgac      2220
     ctggcagcgg gatggggagg accagaccca ggacatggag ctcgtggaga ccaggcccac      2280
     aggggatgga accttccaga agtgggcggt tgtggtagtg ccttctggag aggaacagag      2340
     atacacatgc catgtgcagc acaaggggcc tgcccaagcc cctcatcctg agatggggta      2400
     aggagagaga tgggggcggc catgtctctt agggaaagca ggagcccctc tggagacctt      2460
     tagcagggtc ggggctgggt cctggaggtc agaaccctca cattcccctc ctttcccaga      2520
     gccctctccc cagcccacca tccccattgt gggtatcatt gctggcctgg ttctccttgg      2580
     agctgtggtc actggagctg tggtcactgc tgtgatgtgg aggaagaaga gctcaggtgg      2640
     ggaaggggtg aggagtcggg tttgagtttt cttgtcccac tgggggtttc aagctccagg      2700
     tagaaatgtg ttctgcctgg ttaccgggaa gcaccatcca cattcatggg cctacccagc      2760
     ctgggccctg tgtgccagca cttactcttt tgtaagcacc tgtgacaatg aaggacagat      2820
     ttctcacctt gatgattgta gtgatgggga tctgacccca gtaatcacag gtcaggggaa      2880
     ggtcctgctg aggacagacc ttaggagggc agttggtcag gaccacatct gctttcttgt      2940
     tttctgatcc tgcccttggt ttgcagtcac acatttctgg aaacttctcg aggttccaag      3000
     actaggaggt tcctctagga cctcatggcc ctgctacctt cctggcctct cacaggacgt      3060
     tttcttcccg cagatagaaa aggagggagc tactctcagg ctgcaagtaa gtatgaagga      3120
     ggctgatccc tgagatcctt gggatattgt ggttgggagc catgggggag ctcacccacc      3180
     ccacaattcc tcctctagcc acatctcctg tgggatctga ccaggttctg tttttgttct      3240
     accccaggca gccaaagtgc ccagggctct gatgtgtctc tcacggcttg taaagctgag      3300
     accctgggga ggctgatgtg tgtgggttgt tggggtaaca gtggatatag ctgtgctatg      3360
     gggtttcttt gacttggatg tattcagcac atgatgggct gttgaaggtg tgacccctca      3420
     ctgtgagtga tatgaatttg ttcatgaata ttttttctat agtgtgagac agctgccttg      3480
     tgtgggactg agaggcaaga tttgttcatg ccttcccttt gtgacttcaa gaaccctgac      3540
     ttctctttct gcaaaggcat ctgaatgtgt ctgtgtccct ataggcntaa tgtgaggtgg      3600
     tggggagacc agcccacacc cgtgtccacc atgaccctgt tccccacact gacctacatt      3660
     ccttccccga tcacctttcc tgttccagag aagtggtgct gggatgtctc catctctgtc      3720
     tcaacttcat ggtgcactga gctgtaactt cttacttccc tattaaaatt agaatctgag      3780
     tataaattta cttttttcaa attatttcca tgacgggttg atgggttaat taaaggagaa      3840
     gattcctaaa atttgagaga caaaataaat ggaagacatg agaaccttcc agagtccacg      3900
     tgtttcttgt gctgatttgt tgcaggggag gagagtagat ggggctgtgc ccagtgtgtg      3960
     ctcaggccac catgggcttt atgtggtcac agctcacctg ggtcatcttt gctgctccac      4020
     tgtccttggc ccttcagtag aaccttgtcc caccaggacc tgtgatcaca gggacttgga      4080
     tgtcacctag ggtggtccct acacatcgaa gtccttccgg tatgaagaga caaattttca      4140
     gtcccctgta tcttttgccc tccttccagg tctctttcct ggattgtatt ttccatcttt      4200
     ttccccagcc ttcttaaagg aagcagattc tgaaatttgc agagaggagg ggtcccatag      4260
     tttctcatcg taggtaactt tctgttggaa ctcctcttct gctttcctac tcttcttcct      4320
     gcctgagttg tagtaatccc agtgctggct ccaatccaaa ctcatgcatt tataaagcag      4380
     agtctgattt agatttatat ggggttggaa aattggaccc acaaggctag gattatcttt      4440
     cctgaacaga aaaatatggc tgtgcgctgc agtgtgcagg agggttggtg tgggaggagg      4500
     tgggaaggac acacaagcag ccctggtgag aaaagcactg gcagcactga tgttggtgtg      4560
     agatgatgtt gttctttagc tacgttaata aagatattgc ctttagaata cagaggtgct      4620
     ctacagtgat cattcattca actgacattt gttgtctgct aggtatatga ctgtttttgc      4680
     atttagaaaa catcattaaa gtaaaaacag aaaatttctg gccttgtggt gtatacgnct      4740
     agatg                                                                  4745
//


spacer
spacer