spacer

EBI Dbfetch

ID   M77777; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   M77777;
XX
DT   08-DEC-1991 (Rel. 30, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human HLA-B*5502 mRNA, complete cds.
XX
KW   HLA class I B locus allele; transmembrane glycoprotein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   PUBMED; 1737933.
RA   Hildebrand W.H., Madrigal J.A., Little A.M., Parham P.;
RT   "HLA-Bw22: a family of molecules with identity to HLA-B7 in the alpha
RT   1-helix";
RL   J. Immunol. 148(4):1155-1162(1992).
XX
DR   MD5; 68bba6ba4ddb1b3baf4e049efb92dbb4.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   H-InvDB; HIT000196409_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="EBV TransformeAPA is an EBV Transformed B Cell
FT                   line, B*5502 was cloned from the Oriental APA cell line."
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT                   /gene="HLA-B-5502"
FT                   /number=1
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B-5502"
FT                   /product="HLA-B*5502"
FT                   /db_xref="GOA:P30493"
FT                   /db_xref="H-InvDB:HIT000196409_03.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*55:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="AAA03688.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            74..343
FT                   /gene="HLA-B-5502"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-B-5502"
FT   exon            620..895
FT                   /gene="HLA-B-5502"
FT                   /number=4
FT   exon            896..1012
FT                   /gene="HLA-B-5502"
FT                   /number=5
FT   exon            1013..1089
FT                   /gene="HLA-B-5502"
XX
SQ   Sequence 1089 BP; 223 A; 333 C; 362 G; 171 T; 0 other;
     atgcgggtca cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacct ggggccggac gggcgcctcc tccgcgggca taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer