Dbfetch

ID   M77670; SV 1; linear; genomic DNA; STD; HUM; 261 BP.
XX
AC   M77670;
XX
DT   27-FEB-1992 (Rel. 31, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens lymphocyte DNA (allele DRB1*1410), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-261
RX   DOI; 10.1007/BF00215663.
RX   PUBMED; 1644450.
RA   Gao X., Veale A., Serjeantson S.W.;
RT   "HLA class II diversity in Australian aborigines: unusual HLA-DRB1
RT   alleles";
RL   Immunogenetics 36(5):333-337(1992).
XX
DR   MD5; fa5b7e874e8434f53c2b2edb90370d6e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..261
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..261
FT                   /partial
FT                   /codon_start=1
FT                   /db_xref="GOA:Q31638"
FT                   /db_xref="IMGT/HLA:DRB1*14:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q31638"
FT                   /protein_id="AAA73128.1"
FT                   /translation="FLEQVKHECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVT
FT                   ELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 261 BP; 55 A; 60 C; 98 G; 48 T; 0 other;
     ttcttggagc aggttaaaca tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc        60
     ctggacagat acttccataa ccaggaggag ttcgtgcgct tcgacagcga cgtgggggag       120
     taccgggcgg tgacggagct ggggcggcct gctgcggagc actggaacag ccagaaggac       180
     ctcctggagc ggaggcgggc cgaggtggac acctattgca gacacaacta cggggttgtg       240
     gagagcttca cagtgcagcg g                                                 261
//