Dbfetch

ID   M74031; SV 1; linear; genomic DNA; STD; HUM; 235 BP.
XX
AC   M74031;
XX
DT   15-AUG-1991 (Rel. 29, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens (individual PNG198 and PNG202) HLA-DRB1*1408 gene, partial
DE   cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-235
RX   DOI; 10.1007/BF00215291.
RX   PUBMED; 1612646.
RA   Dong R.P., Kimura A., Sasazuki T.;
RT   "Sequence analysis of three novel DRw14-DRB1 alleles";
RL   Immunogenetics 36(2):130-133(1992).
XX
DR   MD5; 0aeb14306f162e0c2fc2f7cc0ef3f05c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..235
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="granulocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>235
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ-beta-1"
FT                   /note="allele DRB1*1408 exon 2 region"
FT                   /db_xref="GOA:Q29902"
FT                   /db_xref="IMGT/HLA:DRB1*14:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29902"
FT                   /protein_id="AAA62839.1"
FT                   /translation="EYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTEL
FT                   GRPDAEHWNSQKDLLERRRAEVDTYCRHNYGVV"
XX
SQ   Sequence 235 BP; 48 A; 55 C; 89 G; 43 T; 0 other;
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggac        60
     agatacttcc ataaccagga ggagttcgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctgatgcg gagcactgga acagccagaa ggacctcctg       180
     gagcggaggc gggccgaggt ggacacctat tgcagacaca actacggggt tgtgg            235
//