spacer

EBI Dbfetch

ID   M65040; SV 1; linear; genomic DNA; STD; HUM; 173 BP.
XX
AC   M65040;
XX
DT   13-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC HLA-DQB1 allele DBQ3.1 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-173
RX   DOI; 10.1007/BF01719235.
RX   PUBMED; 2010218.
RA   Bugawan T.L., Erlich H.A.;
RT   "Rapid typing of HLA-DQB1 DNA polymorphism using nonradioactive
RT   oligonucleotide probes and amplified DNA";
RL   Immunogenetics 33(3):163-170(1991).
XX
DR   MD5; e2032cb19170ad03d512a5aa1166c8ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..173
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..173
FT                   /partial
FT                   /codon_start=3
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:Q29997"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29997"
FT                   /protein_id="AAA36239.1"
FT                   /translation="TELVRGVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQK
FT                   DILEEDRASVDT"
XX
SQ   Sequence 173 BP; 35 A; 43 C; 69 G; 26 T; 0 other;
     ggaccgagct cgtgcggggt gtgaccagat acatctataa ccgagaggag tacgcgcgct        60
     tcgacagcga cgtgggggtg tatcgggcgg tgacgccgct ggggcggctt gacgccgagt       120
     actggaatag ccagaaggac atcctggagg aggaccgggc gtcggtggac acc              173
//


spacer
spacer