Dbfetch

ID   M64794; SV 1; linear; genomic DNA; STD; HUM; 225 BP.
XX
AC   M64794; M37769;
XX
DT   13-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DRB1*0409 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-225
RX   DOI; 10.1007/BF01719244.
RX   PUBMED; 2010223.
RA   Lanchbury J.S.S., Jaeger E.E.M., Welsh K.I., Panayi G.S.;
RT   "Nucleotide sequence of a novel HLA-DRB4B1 allele, DRB1*0409";
RL   Immunogenetics 33(3):210-212(1991).
XX
DR   MD5; 871b3a86317d7b0b165b0d42e1073750.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..225
FT                   /organism="Homo sapiens"
FT                   /strain="Caucasoid"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-DR4"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>225
FT                   /codon_start=2
FT                   /product="MHC class II HLA-DR-beta-1*0409"
FT                   /db_xref="GOA:Q30122"
FT                   /db_xref="IMGT/HLA:DRB1*04:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30122"
FT                   /protein_id="AAA36273.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSA
FT                   EYWNSQKDLLEQKRAAVDTYCRHNYGVGE"
XX
SQ   Sequence 225 BP; 49 A; 55 C; 84 G; 37 T; 0 other;
     tgagtgtcat ttcttcaacg ggacggagcg ggtgcggttc ctggacagat acttctatca        60
     ccaagaggag tacgtgcgct tcgacagcga cgtgggggag taccgggcgg tgacggagct       120
     ggggcggcct agcgccgagt actggaacag ccagaaggac ctcctggagc agaagcgggc       180
     cgcggtggac acctactgca gacacaacta cggggttggt gagag                       225
//