spacer

EBI Dbfetch

ID   M64741; SV 1; linear; genomic DNA; STD; HUM; 1098 BP.
XX
AC   M64741;
XX
DT   23-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-A*2403 gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1007/BF00216625.
RX   PUBMED; 1729171.
RA   Little A.M., Madrigal J.A., Parham P.;
RT   "Molecular definition of an elusive third HLA-A9 molecule: HLA-A9.3";
RL   Immunogenetics 35(1):41-45(1992).
XX
DR   MD5; ac6a42cedcd73bb91553817d2777bb9e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="APA and KPE"
FT                   /tissue_type="EBV transformed B cell"
FT                   /db_xref="taxon:9606"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /note="G00-119-310"
FT   CDS             join(1..73,74..343,344..619,620..895,896..1012,1013..1098)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /db_xref="GOA:P05534"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*24:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:2BCK"
FT                   /db_xref="PDB:3I6L"
FT                   /db_xref="PDB:3NFN"
FT                   /db_xref="PDB:3QZW"
FT                   /db_xref="PDB:3VXM"
FT                   /db_xref="PDB:3VXN"
FT                   /db_xref="PDB:3VXO"
FT                   /db_xref="PDB:3VXP"
FT                   /db_xref="PDB:3VXR"
FT                   /db_xref="PDB:3VXS"
FT                   /db_xref="PDB:3VXU"
FT                   /db_xref="PDB:3W0W"
FT                   /db_xref="PDB:3WL9"
FT                   /db_xref="PDB:3WLB"
FT                   /db_xref="PDB:4F7M"
FT                   /db_xref="PDB:4F7P"
FT                   /db_xref="PDB:4F7T"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05534"
FT                   /protein_id="AAA59601.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /number=2
FT                   /note="G00-119-310"
FT   exon            344..619
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /number=3
FT                   /note="G00-119-310"
FT   exon            620..895
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /number=4
FT                   /note="G00-119-310"
FT   exon            896..1012
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /number=5
FT                   /note="G00-119-310"
FT   exon            1013..>1098
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /note="G00-119-310"
XX
SQ   Sequence 1098 BP; 223 A; 331 C; 363 G; 181 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggacgagga gacagggaaa gtgaaggccc actcacagac tgaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggttctca caccctccag       360
     atgatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac caagcgcaag tgggaggcgg cccatgtggc ggagcagcag       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagcca       900
     tcttcccagc ccaccgtccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaacagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer