Dbfetch

ID   M63508; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   M63508;
XX
DT   12-APR-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DPB1 gene, exon 2 and partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RA   Clay T.M., Bidwell J.L., Martin A.F., Bradley B.A.;
RT   "A new DPB1 allelic sequence";
RL   Unpublished.
XX
DR   MD5; eba710fb4f66b7839341fc9194d523b6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..249
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT                   /note="G00-120-636"
FT   CDS             1..249
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II HLA-DP-beta-1"
FT                   /db_xref="GOA:Q30029"
FT                   /db_xref="IMGT/HLA:DPB1*20:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30029"
FT                   /protein_id="AAA59738.1"
FT                   /translation="VYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELG
FT                   RPDEDYWNSQKDLLEEKRAVPDRMCRHNYELDEAVTLQ"
XX
SQ   Sequence 249 BP; 58 A; 60 C; 92 G; 39 T; 0 other;
     gtgtaccagt tacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgatgaggac tactggaaca gccagaagga cctcctggag       180
     gagaagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccgtg       240
     accctgcag                                                               249
//