Dbfetch

ID   M63454; SV 1; linear; genomic DNA; STD; HUM; 3950 BP.
XX
AC   M63454;
XX
DT   20-APR-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class I HLA-B-3502 gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3950
RX   DOI; 10.1016/0198-8859(91)90020-A.
RX   PUBMED; 1890016.
RA   Chertkoff L.P., Herrera M., Fainboim L., Satz M.L.;
RT   "Complete nucleotide sequence of a genomic clone encoding HLA-B35 isolated
RT   from a Caucasian individual of Hispanic origin. Identification of a new
RT   variant of HLA-B35";
RL   Hum. Immunol. 31(3):153-158(1991).
XX
DR   MD5; 9e488652996a6f9de432eb411a8d25dd.
XX
CC   A new allelic variant isolated from an individual with hispanic
CC   background.  Differs in 3 nucleotides from the oriental allele
CC   B*3501, with substitution at residues 109, 114 and 116.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3950
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A3,33/B35,X/CW4,X"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(669..741,871..1140,1387..1662,2238..2513,2618..2734,
FT                   3176..3208,3315..3358)
FT                   /gene="HLA-B"
FT   exon            <669..741
FT                   /gene="HLA-B"
FT   CDS             join(669..741,871..1140,1387..1662,2238..2513,2618..2734,
FT                   3176..3208,3315..3358)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /db_xref="GOA:P30685"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*35:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1A1N"
FT                   /db_xref="PDB:1A9B"
FT                   /db_xref="PDB:1A9E"
FT                   /db_xref="PDB:1CG9"
FT                   /db_xref="PDB:1XH3"
FT                   /db_xref="PDB:1ZHK"
FT                   /db_xref="PDB:1ZHL"
FT                   /db_xref="PDB:1ZSD"
FT                   /db_xref="PDB:2AK4"
FT                   /db_xref="PDB:2AXF"
FT                   /db_xref="PDB:2AXG"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="PDB:2H6P"
FT                   /db_xref="PDB:2NW3"
FT                   /db_xref="PDB:2NX5"
FT                   /db_xref="PDB:3BW9"
FT                   /db_xref="PDB:3BWA"
FT                   /db_xref="PDB:3KWW"
FT                   /db_xref="PDB:3KXF"
FT                   /db_xref="PDB:3LKN"
FT                   /db_xref="PDB:3LKO"
FT                   /db_xref="PDB:3LKP"
FT                   /db_xref="PDB:3LKQ"
FT                   /db_xref="PDB:3LKR"
FT                   /db_xref="PDB:3LKS"
FT                   /db_xref="PDB:3MV7"
FT                   /db_xref="PDB:3MV8"
FT                   /db_xref="PDB:3MV9"
FT                   /db_xref="PDB:3VFS"
FT                   /db_xref="PDB:3VFT"
FT                   /db_xref="PDB:3VFU"
FT                   /db_xref="PDB:3VFV"
FT                   /db_xref="PDB:3VFW"
FT                   /db_xref="PDB:4LNR"
FT                   /db_xref="PDB:4PR5"
FT                   /db_xref="PDB:4PRN"
FT                   /db_xref="PDB:4QRR"
FT                   /db_xref="PDB:5XOS"
FT                   /db_xref="PDB:5XOT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30685"
FT                   /protein_id="AAA59682.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRFLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            871..1140
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            1387..1662
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            2238..2513
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2618..2734
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            3176..3208
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            3315..>3358
FT                   /gene="HLA-B"
XX
SQ   Sequence 3950 BP; 792 A; 1101 C; 1201 G; 856 T; 0 other;
     aatcattcag ggattaccaa tattgtgcta cctactgtat caataaacaa aaaggaaact        60
     ggtctctatg agaatctctg tgtggtggct tcagacaaaa cttcgccagg tttagagaga       120
     aaacccctgt ctctacacct ccattcccag ggcgagctca ctctctggca tcaagttctc       180
     cgtgatcagt ttccctacac aagatccaag aggagaggta aggagtgaga ggcagggagt       240
     ccagttcagg gacagggatt ccaggaggag aagtgaaggg gaagcgggtc gggcagcctg       300
     ggggtctctc cctggtttcc acagacagat ccttgtgcag gactcaggca gacagtgtga       360
     caaagaggct ggtgtaggag aagagggatc aggacgaagt cccagccgcg ggcggggctc       420
     tcagggtctc aggctccgag agccttgtct gcattgggga ggcgcagcgt tggggattcc       480
     ccactcccac gagtttcact tcttctccca acctatgtcg ggtccttctt ccaggatact       540
     cgtgacgcgt ccccatttcc cactccattg ggtgtcggat atctagagaa gccaatcagt       600
     gtcgccgggg tcccagttct aaagtcccca cgcacccacc cggactcaga atctcctcag       660
     acgccgagat gcgggtcacg gcgccccgaa ccgtcctcct gctgctctgg ggggcagtgg       720
     ccctgaccga gacctgggcc ggtgagtgcg gggtcgggag ggaaatggcc tctgtgggga       780
     ggagcgaggg gaccgcaggc gggggcgcag gacctgagga gccgcgccgg gaggagggtc       840
     gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat ttctacaccg       900
     ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac gtggacgaca       960
     cccagttcgt gaggttcgac agcgacgccg cgagtccgag gacggagccc cgggcgccat      1020
     ggatagagca ggaggggccg gagtattggg accggaacac acagatcttc aagaccaaca      1080
     cacagactta ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg      1140
     gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt acggcccggg      1200
     gtcgccccga gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac      1260
     cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa      1320
     tccccgcggg ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcggggccgg      1380
     ggccagggtc tcacatcatc cagaggatgt atggctgcga cctggggccc gacgggcgct      1440
     tcctccgcgg gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg      1500
     acctgagctc ctggaccgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg      1560
     cggcccgtgt ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtggctcc      1620
     gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg      1680
     agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat      1740
     gggatcagcg ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt      1800
     ttcctctgag ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat      1860
     ggaggggaag acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc      1920
     ttgggaaccg tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg      1980
     ggctctgatt ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc      2040
     ctgttccccg ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc      2100
     gtccaggctg gtgtctgggt tctgtgcccc ttccccacac caggtgtcct gtccattctc      2160
     aggctggtca catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt      2220
     ctgactcttc ccatcagacc ccccaaagac acacgtgacc caccaccccg tctctgacca      2280
     tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg      2340
     gcagcgggat ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg      2400
     agatagaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata      2460
     cacatgccat gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga      2520
     gggggatgag gggtcatatc tcttctcagg gaaagcagga gcccttctgg agcccttcag      2580
     cagggtcagg gcccctcgtc ttcccctcct ttcccagagc catcttccca gtccaccatc      2640
     cccatcgtgg gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg      2700
     gtcgctactg tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc      2760
     tgggttttct tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt      2820
     actgggaagc agcatccaca caggggctaa cgcagcctgg gaccctgtgt gccagcactt      2880
     actcttttgt gcagcacatg tgacaatgaa ggacggatgt atcaccttga tggttgtggt      2940
     gttggggtcc tgatttcagc attcatgagt caggggaagg tccctgctaa ggacagacct      3000
     taggagggca gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgcctt      3060
     gggtctgtag tcatacttct ggaaattcct tttgggtcca agacgaggag gttcctctaa      3120
     gatcttaagg ccctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga      3180
     aaaggaggga gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct      3240
     cacccacccc ataattcctc ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt      3300
     ttgttctact ccagccagcg acagtgccca gggctctgat gtgtctctca cagcttgaaa      3360
     aggtgagatt cttggggtct agagtgggcg gggggggcgg ggagggggca gaggggaaag      3420
     gcctgggtaa tggagattct ttgattggga tgtttcgcgt gtgtcgtggg ctgttcagag      3480
     tgtcatcact taccatgact aaccagaatt tgttcatgac tgttgttttc tgtagcctga      3540
     gacagctgtc ttgtgaggga ctgagatgca ggatttcttc actcctcccc tttgtgactt      3600
     caagagcctc tggcatctct ttctgcaaac ggcacctgaa tgtgtctgcg tccctgttag      3660
     cctaatgtga ggaggtggag agacagccca cccccgtgtc cactgtgacc cctgttccca      3720
     tgctgacctg tgtttcctcc ccagtcatct ttcttgttcc agagaggtgg ggctggatgt      3780
     ctccatctct gtctcaactt tatgtgcact gagctgcaac ttcttacttc cctactgaaa      3840
     ataagaatct gaatataaac ttgttttctc aaatatttgc tatgagaggt tgatggatta      3900
     attaaataag tcaattcctg gaatttgaga gagcaaataa agacctgaga                 3950
//