Dbfetch

ID   M62852; SV 1; linear; mRNA; STD; HUM; 1017 BP.
XX
AC   M62852;
XX
DT   24-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class I HLA-B27-HS mRNA, 3' end.
XX
KW   cell surface antigen; class I gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1017
RX   PUBMED; 1711072.
RA   Choo S.Y., Fan L.A., Hansen J.A.;
RT   "A novel HLA-B27 allele maps B27 allospecificity to the region around
RT   position 70 in the alpha 1 domain";
RL   J. Immunol. 147(1):174-180(1991).
XX
DR   MD5; 2111536a1cb15d3d25c04741a4ee48ff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1017
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..1017
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC HLA-B27-HS"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="PDB:5DEF"
FT                   /db_xref="PDB:5DEG"
FT                   /db_xref="PDB:5IB1"
FT                   /db_xref="PDB:5IB2"
FT                   /db_xref="PDB:5IB3"
FT                   /db_xref="PDB:5IB4"
FT                   /db_xref="PDB:5IB5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="AAA59647.1"
FT                   /translation="GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPRE
FT                   EPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQSMYGCDVG
FT                   PDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGE
FT                   CVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGE
FT                   DQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQST
FT                   VPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 1017 BP; 207 A; 308 C; 343 G; 159 T; 0 other;
     ggctcccact ccatgaggta tttccacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatca ccgtgggcta cgtggacgac acgctgttcg tgaggttcga cagcgacgcc       120
     gcgagtccga gagaggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gaccgggaga cacagatctg caaggccaag gcacagactg accgagagga cctgcggacc       240
     ctgctccgct actacaacca gagcgaggcc gggtctcaca ccctccagag catgtacggc       300
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc ctacgacggc       360
     aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgccgcgga cacggcggct       420
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag agcctacctg       480
     gagggcgagt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       540
     cgcgcggacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc       600
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat       660
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc       720
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat       780
     gtacagcatg aggggctgcc gaagcccctc accctgagat gggagccgtc ttcccagtcc       840
     accgtcccca tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga       900
     gctgtggtcg ctgctgtgat gtgtaggagg aagagctcag gtggaaaagg agggagctac       960
     tctcaggctg cgtgcagcga cagtgcccag ggctctgatg tgtctctcac agcttga         1017
//